SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G51967.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G51967.1
Domain Number 1 Region: 516-628
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.97e-28
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 77-194
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-21
Family alpha-D-mannose-specific plant lectins 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G51967.1   Gene: BRADI2G51967   Transcript: BRADI2G51967.1
Sequence length 638
Comment pep:novel chromosome:Brachy1.0:2:51484168:51489163:-1 gene:BRADI2G51967 transcript:BRADI2G51967.1
Sequence
MASIDFYHHLLLSLALLLLLPTACQARDTVTPGRPLGANETLVSGGDASFVLGFFTPPGG
NGTYLGVWYSKVSVRTVVWVANRERPIPGHVADNLGRATLSVSATGTLSIVNAAGNNNSR
HVVVWSVTPASRLASPTAKILDNGNLVLADGNGVAAWQGFDHPTDTLLPDMKLGIDYVTG
RNRTLTAWKSPSDPSPGPVVMAMDTSGDPQVFIWNGGEKVWRSGPWDGVQFTGVPDTVTY
SGFTFSFVNDAREVTYSFHVHRESIISRLGLNSTGNYGLLQRSTWVESAGTWNLYWYAPK
DQCDAVSPCGPNGVCDTNNLPVCSCLRGFSPRSPAAWALRDGRDGCVRTTPLDCRNGSTG
AGDDGFVAVRHAKVPDTARSVVDRGLSLEQCREACLGNCSCTAYASANVVGGDRRGTGSG
CVMWNSGLTDLRVYPDFGQDLFVRLAAADLGLSSKSRKGSTIIIIAVAASISALAFLLAL
AGFLVCARKKKRSRKTGSSKWSGSSRSNARRYEGSSHGEDLELPIFDLGTIAAATDGFSI
NNKLGEGGFGPVYKGKLEDGQEIAVKTLSKTSVQGLDEFKNEVMLIAKLQHRNLVRLLGY
SISGQERILVYEYMENKSLDYFLFGKLSTLLFLTLYFG
Download sequence
Identical sequences I1HSB9
EG:BRADI2G51967.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]