SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G52090.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G52090.1
Domain Number 1 Region: 94-421
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 4.45e-89
Family Catechol oxidase 0.000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G52090.1   Gene: BRADI2G52090   Transcript: BRADI2G52090.1
Sequence length 577
Comment pep:novel chromosome:Brachy1.0:2:51593048:51595095:-1 gene:BRADI2G52090 transcript:BRADI2G52090.1
Sequence
MAMSTRCHAPLAACVFLVCAVSMAVYTAFPLSMSPCTNSLSRALLAISGLDPYITSCADH
DDASAARLSDGGGSDNIIGGPIVTNLLTCGNATLPPHALPPFYCCPPMTTAEPINFTFPD
PSEPLRVRRPAHAVGAEYMAKYERVIALMKALPHSDPRSFYQVANIHCAYCTTSYRQANP
KLGVQIHFSWLFFTFHRAHLYFFERIAAKLLGEPEFALPFWSWDVPEGMRMPVEFANSSS
VLYDPIRNPSHAPPKLVDLDFLGPEKNFTDEQQIQHNLRVMYKQMIGNAALPSLFHGQPY
RAGQNDMPGAGTVELAPHNTVHTWTGDITLPNVENMGDYYSAGRDPIFYPHHNNIDRLWQ
AWRDAGVARGYRGHVDFTDPDWLDSSFLFYNEDARLVRITVRDVLDTEKLRYTHAGVGMP
WLDAKPPTTPNVNTKKGSLKSVRFPVSLDAAVSAEVRRPRVLRSRHEKMAQEEVLVVEGV
ETNGNELVKFDVFVNAMEHEKVEAGGRELAGTFVSMKQPSMDHRTGKRKPMKTSMRVALN
ELLEDLGADGDESVTVTLVPRRGNVRIGGLRIVYMTE
Download sequence
Identical sequences I1HSD3
EG:BRADI2G52090.1 XP_003567194.1.954 15368.BRADI2G52090.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]