SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G53090.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G53090.1
Domain Number 1 Region: 310-422
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.56e-28
Family LexA repressor, N-terminal DNA-binding domain 0.092
Further Details:      
 
Domain Number 2 Region: 8-123
Classification Level Classification E-value
Superfamily PH domain-like 0.000000203
Family VPS36 N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G53090.1   Gene: BRADI2G53090   Transcript: BRADI2G53090.1
Sequence length 447
Comment pep:novel chromosome:Brachy1.0:2:52308229:52311527:-1 gene:BRADI2G53090 transcript:BRADI2G53090.1
Sequence
MSVAAADWLPSATVTASGRPVLSAGEIERHLLPLVDLEPEENPSRAPLRGCLLALTSRRL
IFLHEPSLSARALPLASIVHPYPPHRRHNHNPLRSIFSSSSSSSSHHPRIRLQISLPPSR
SEVVAVVVTCKADVDVFYGRLLEAMRARAWEAAPAAVPASGASAAGGSAPAVEEDIATRM
PVVGVSGILRKEQETWESAGQNLQDAFQDLNALMSKAKEMMELAEKMRQKLLTNSSAQSN
SGDEEMGSKQDMQDLLLSVGIVSPVTKETAGALYHQQLSRQLADFVRIPVEKAGGMIALV
DVYCLFNRARGTELISPEDLLQACSLWEKFDVPVMLRKFDSGVKVIQTKSHSDDEVFARI
SSLAQKLNALQKGISPSDAALTLGITPALAKEHLLNAENKGLLCRDVSPDGFRFYINLFN
EIDPKNIYLSKTYGLYHTWISVATAAH
Download sequence
Identical sequences I1HSQ3
15368.BRADI2G53090.1 EG:BRADI2G53090.1 XP_003564459.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]