SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G55250.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G55250.1
Domain Number 1 Region: 68-216
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.00000002
Family CAT-like 0.083
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G55250.1
Domain Number - Region: 323-389
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0136
Family NRPS condensation domain (amide synthase) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G55250.1   Gene: BRADI2G55250   Transcript: BRADI2G55250.1
Sequence length 497
Comment pep:novel chromosome:Brachy1.0:2:53920873:53922781:1 gene:BRADI2G55250 transcript:BRADI2G55250.1
Sequence
MAMMDAVPSASSIMQQPKAQDISTVDAPLSGSGSGITVVSRHAVRPDGPPSAVGDLTLSV
SDLPMLSCHYIQKGLFFPAPDVPMASLVSLLLSSLSRALAVFPALAGRLVTLPDDRIVIR
CNGAGVEFHHAVAPALSLDDFLVPNADVPTGLTKDLFPMDRTVSYEGHRRPLTSFQVTVL
GDGAVFIGIVANHAVVDGTSFWHFFNAWAALCRGASPRIPDFRRNFFGDSKAVLRFPGGV
GPAVTFDADAPIRERIFHFSRDAIRELKALANRRPSSSSAAAAAGGQDAEVYGKMAHDPK
NTEGEISSFQSLCAQIWIATTRARKRLASDATTTLRVAVNCRHRLRPAISAAYFGNAIQS
APTTATVSELASGDLRWAAARLHASLAAYGDSAIRGAAAAWQAAPRCFPLGNPDGAVVTM
GSSNRFPMYEGNDFGWGRPLAVRSGRANKFDGKMSAFPGRAGDGSVDIEICLEPDTMAAL
LRDAQFMQYVSCPSHLL
Download sequence
Identical sequences I1HTH3
EG:BRADI2G55250.1 15368.BRADI2G55250.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]