SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G55930.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G55930.1
Domain Number 1 Region: 4-316
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-84
Family Protein kinases, catalytic subunit 0.00000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G55930.1   Gene: BRADI2G55930   Transcript: BRADI2G55930.1
Sequence length 930
Comment pep:novel chromosome:Brachy1.0:2:54398359:54403392:-1 gene:BRADI2G55930 transcript:BRADI2G55930.1
Sequence
MESRMDQYEIMEQIGRGAFGAAILVNHKTEKKKYVLKKIRLARQTERCRKSAHQEMALIA
RLQHPYIVEFKEAWVEKGCYVCIVTGYCEGGDMAELMKKANGTYFPEEKMLRWFAQLALA
VGYLHSNYVLHRDLKCSNIFLTKDQDIRLGDFGLAKTLKEDDLTSSVVGTPNYMCPELLT
DIPYGFKSDIWSLGCCMYEMAAHRPAFKAFDMAGLISKINRSSIGPLPTCYSSSMKTLIK
SMLRKSPEHRPTAFEILKNPYLQPYVNQHRPFSDVPHPMRSPEKSITSSRSSRRSMSGSQ
CSSISGTGSDMDSIQSSERNTSGLASSSNTTTIDTEDAEATDDVSVKRFSTPHDLKSCKN
TARSNLERQDSCKSIHVDQHPKYVSKQPKIIKKILTTLREETSKLRVHNSPLRASRVKLC
PPSHRERSPDDSKHNSDISSSSKSSEVTSHESGKATFEPAKQIQESPPMKHLSPIGEHSP
KSNIKVDELHHLDSAKQTMENVDAAEGKVKNRMLPKFNKRPSFPPRRQMGAESPQHTGTQ
RAHNKVVTEHAKSPCQPAHGPKNALTEPPGILIAPPSPLGGIPIKVGNSRAKSTPLKAVA
TKEVSTACSSSTVDYADGIRQTGEPDSPTNLVSSCKCPIPDSAIQKHDLTAIPSPELNTT
TLQKSIASSDDISLSSALDPSFDVSEQDFICKDDVPCSKMGQSTAVVTVESDEDKFTVQE
LLSSVPDILPFDSTTNIALDEGPASVHHSSQKVPVFHLSPAVEDANVIRRSSFCLGNEQV
VTENAEMGIQSTDVSHLQDVIKEEVDVRSIPPNHIPSVLIDSAAAKPNVSEATTICPELA
SSDVVKLPSIPEANSMSKEILDVKSFRQRSEALEGLLELSADLLQNNRLEELAVVLKPFG
KAKVSPRETAIWLARSFKGLMNDEASRSSL
Download sequence
Identical sequences I1HTP8
XP_010232603.1.954 XP_010232604.1.954 XP_014754888.1.954 15368.BRADI2G55930.1 EG:BRADI2G55930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]