SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G56460.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G56460.1
Domain Number 1 Region: 45-346
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-84
Family Protein kinases, catalytic subunit 0.000000417
Further Details:      
 
Domain Number 2 Region: 317-337,383-502
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-26
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G56460.1   Gene: BRADI2G56460   Transcript: BRADI2G56460.1
Sequence length 503
Comment pep:novel chromosome:Brachy1.0:2:54795385:54798624:-1 gene:BRADI2G56460 transcript:BRADI2G56460.1
Sequence
MAVGGDDDMERDFAARLRLAPSPSSASASASPTAAAAGGGSGIAFRAPQEQFTVDEFELG
RIYGVGSYSKVVRAKKKDTGNVYALKIMDKKFITKENKISYVKMERIVLDQLDHPGVIRL
FFTFQDTYSLYMALESCEGGELFDQIIRKGRLSEDEARFYAAEIVDILEYLHSVGLIHRD
VKPENLLLTSDGHIKIADFGSVKPTRDTPIKVLPNSTTERACTFVGTAAYVPPEVLNSAP
ATFGNDLWALGCTLFQMLSGSSPFKDASEWLIFQRITARDLRFPQYFSDEARDLVDKLLD
MDPIKRPGAGPDGYASLKKHPFFRGIDWKNIRKTRAPKLAVEENANEDDDTQDSDWLSHM
GSAPVNQHVPVGNNGAASSSEVRSHVSKLASIDSFDSRWQEFLEPGESVVLISKLKKINK
LSNKKVQLILTNKPQLICVDPAKMETKGNIIWSDDPSELNVQVTNSSHFRICTPKKVFIF
EDAKQRAWQWKNAIEDLQHCQKN
Download sequence
Identical sequences I1HTV2
EG:BRADI2G56460.1 XP_003564737.1.954 15368.BRADI2G56460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]