SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G56927.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G56927.1
Domain Number 1 Region: 279-566
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.37e-70
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G56927.1
Domain Number - Region: 39-138
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0115
Family Universal stress protein-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G56927.1   Gene: BRADI2G56927   Transcript: BRADI2G56927.1
Sequence length 586
Comment pep:novel chromosome:Brachy1.0:2:55181747:55185927:-1 gene:BRADI2G56927 transcript:BRADI2G56927.1
Sequence
MVVVALDATRDHREEEVRLALKTLVARGDILRGGGSLLVLLVLHAVTNPMGYQTKASSDS
FAGTSLRYLGEQVMKKSEYYRDKLLHDVEELRKVGISVTLKVSPGSPAKVVIIHEVNSSQ
AAWVVLDRHFRRDFKHLQKHIACKVAAFQDNLSVQTLKSIRTKVLSRSMGEAKDLRHLAV
SLDLSSKSVDTDKFRVSIKSSPVSYFASLSNHEIQYTPSVVGSSMQDFTPSMSTTSITMI
DETEFLPNGKCTEDNIICHYDTSERPVLCAGCGLRSVLYIKESMKYPFSEIQSATSDFSS
ENLLGEGGFGHVYKGQLKDGQVIAAKLHKEASSQGYTEFFSEVQVLSFARHRNIVMLLGY
CCKESYNILVYEYICNNSLEWHLFDKSAGLLEWHKRHAIALGIAKGLRFLHEECRAGPII
HRDLRPSNVLLTHDFVPMLGDFGLAKWKAGNASIHTRILGQSGYLAPEYAEYGIVSVRTD
VYAFGIVLFQLISGRKVLEECEGQCTHILQWAEPLVENLALHDLIDERIADTYDTYGLYH
LARAAYLCVRTNPEQRPSMGEVVRLIETENEHIRDLSRQFIPHFTK
Download sequence
Identical sequences I1HU02
EG:BRADI2G56927.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]