SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G58667.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G58667.1
Domain Number 1 Region: 299-340
Classification Level Classification E-value
Superfamily WW domain 0.0000000000529
Family WW domain 0.0022
Further Details:      
 
Domain Number 2 Region: 258-293
Classification Level Classification E-value
Superfamily WW domain 0.00000000181
Family WW domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G58667.1   Gene: BRADI2G58667   Transcript: BRADI2G58667.1
Sequence length 538
Comment pep:novel chromosome:Brachy1.0:2:56481500:56486077:-1 gene:BRADI2G58667 transcript:BRADI2G58667.1
Sequence
MNNSHGQPLPPGVGTWQPPPSNHPSQFQPSPRPHAYPTPYDTRPNGGNNQNTANVFYATQ
PFHPSPHPHAYPAPYDTRPNNGSNQDTSNLFYATQPNTPLLPAQSTPNAPTDPGNWQAHQ
TAHEVANHNGSAANIESAVQEAVLHEQDIETQQVIQNQRQANATSEPAEYGEDMLLSRRD
PNALKEHLLKMTVDHRAEMANKRGKSLQHDNDKPKDGADDLPEFLKQRLKARGILKDKAA
NDNSAAKQKADSQEGHNISAQELPPGWVEAKDPTTGASYFYNQSTGVTQWDRPGGAVNPV
QHQAAPSLPENWEEALDKSTGQKYYYNTKTHATQWEPPTSVQPGVVPHASTDVAVQPTAQ
NADLCNPHMQRCSGCGGWGIGLVQPWGYCNHCTRVQNLPFQQYPSYSNNIVQSSGTNAPK
IQGNVATKDRSSTKPPSGKANKKDNRKRNHAEDDELDPMDPSSYSDAPRGGWVVGLKGVQ
PRAADTTASGPLFQQRPYPSPGAVLRKNAEVASNGKKRGGMAAISKRGDGSDGLGEAD
Download sequence
Identical sequences I1HUJ7
EG:BRADI2G58667.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]