SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G60892.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G60892.1
Domain Number 1 Region: 39-182
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000004
Family NRPS condensation domain (amide synthase) 0.036
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G60892.1
Domain Number - Region: 228-396
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0356
Family NRPS condensation domain (amide synthase) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G60892.1   Gene: BRADI2G60892   Transcript: BRADI2G60892.1
Sequence length 436
Comment pep:novel chromosome:Brachy1.0:2:58132722:58134228:1 gene:BRADI2G60892 transcript:BRADI2G60892.1
Sequence
MGAKEEVKVLESCLVMPGEETPTHGLWLSPLDLVLAGRGHTPAVYFYRFVSGSTGDFFDV
AKLKAAMAKALVAFYPLAGRLRVDDSGRTEIDCAGQGVLFVVAHSDFAADDFNDCQPSPE
LRKLFVPHIDGSSGIVFGVQVTFLKCGGVALGTALHHVAADGVSAFHFFQTWSAFSRNNG
ENVTTTLDLPCHDRTLLRARCPPVVHPDSLDVFYPFKINPCEPLGPIINKIFAISDDQVD
ALKRACGGVSTFCAVTTHVWRCLCAARQLPSDTTTRLTFTANVRGRMRPPLPAHYFGNAI
IWLTSAGKVHDVASPSKEMMASVASRIRGTIRRMDEEVVHSAIDYLEQQETGNKPAPPSG
NSLSKTELRVVSWLGMPVYDADFGWGKPLMMLRAVVPRAGVVFLMDGGRGDGSVHILICM
ETAILTDFQRLLYAPV
Download sequence
Identical sequences I1HV89
XP_010232822.1.954 EG:BRADI2G60892.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]