SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G00857.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G00857.1
Domain Number 1 Region: 118-213
Classification Level Classification E-value
Superfamily Single hybrid motif 9.29e-27
Family Biotinyl/lipoyl-carrier proteins and domains 0.000055
Further Details:      
 
Domain Number 2 Region: 315-402
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 8.9e-21
Family CAT-like 0.0052
Further Details:      
 
Domain Number 3 Region: 253-298
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000017
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G00857.1   Gene: BRADI3G00857   Transcript: BRADI3G00857.1
Sequence length 403
Comment pep:novel chromosome:Brachy1.0:3:465613:469480:1 gene:BRADI3G00857 transcript:BRADI3G00857.1
Sequence
MSAAHLLRHSRKLRSLRNVVDCERAGLARFFSTGSCSFAVKENGVEKRIGGSTFSQCDQP
GKDLQTFKVSLGGVIRSSTCRRTPSSRISSAVTGINGSLSRVQVLSSRSFSSSADLPPHQ
EIGMPSLSPTMTEGNIAKWVKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVQGD
GAKEIKVGEIICVTVEEEGDIEKFKDYKPSTSSDAPVAPAESKPKSEPAEPKVEEKEPAK
APEPKALKTAEPQRSGDRIFSSPLARKLAEDTNVPLSSVKGTGPDGRILKADIEDYLASV
AKGGKSESFAASGLDYTDIPNAQIRKVTANRLLTSKQTIPHYYLTVDTCVDKLIKLRGEL
NPLQDASGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQ
Download sequence
Identical sequences I1HW50
EG:BRADI3G00857.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]