SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G00880.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G00880.1
Domain Number 1 Region: 212-282
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00000000000811
Family Biotinyl/lipoyl-carrier proteins and domains 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G00880.1   Gene: BRADI3G00880   Transcript: BRADI3G00880.1
Sequence length 302
Comment pep:novel chromosome:Brachy1.0:3:477274:481137:1 gene:BRADI3G00880 transcript:BRADI3G00880.1
Sequence
MGSRQLCDQYATHLAAAAHAGGRHGALLPHARRVFDATPERNLVTGNSLLSALARARGHV
RDMERLFASLPRRDAVSYNALLAGLARAGAHARAAGAYRALLRDEDGVRPSRITMLGLVM
DASALGDRALGRQAHGQILRLGFAAYAFTGSPLVGMYAKAGLVGDARRVFDEMEGNNVVL
RKESRALDFLSTINLGKIIRPSRYYHQGLSQVVQGNIAKWVKKEGDKVSPGEVLCKVETQ
LLSLIFEFFPLDKATVEMECMEEGYLAKIVQGDGAKEIKVGEKRVASRSLKTTNLQHLQM
RL
Download sequence
Identical sequences I1HW53
EG:BRADI3G00880.1 15368.BRADI3G00880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]