SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G01180.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G01180.1
Domain Number 1 Region: 399-701
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-74
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 293-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000963
Family EGF-type module 0.0072
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G01180.1
Domain Number - Region: 258-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0121
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G01180.1   Gene: BRADI3G01180   Transcript: BRADI3G01180.1
Sequence length 738
Comment pep:novel chromosome:Brachy1.0:3:751546:754885:-1 gene:BRADI3G01180 transcript:BRADI3G01180.1
Sequence
MAGALPWLIFAATLLLPTIKSSTASRMAKPGCRETCGNLTIPYPFGIGEGCFREGFDVSC
ENDTVYRHNSTTSGIQIYNINLLGGQATHSTFIASNCFYNKNNFNTGGWASLDTGEFFTV
SSKANKLTAVGCNTLAFLVGSNEHSVGAGCFSKCTDKKSVDRSGQCSGMGCCQTSIAPNV
FSSNITFDLRFNNSEVSSFNPCSYAFVAKQDWFKFKAYYLEYDKFTKEFKDGVPTVLDWV
AGNENCNEAVKNMSSYACIGKNSHCIESPNATGYLCTCNDGFAGNPYLEEGCQDIDECSF
PDQYPCHGICSNMIGNYSCLCKSGTRSTDPKKETCNPVGVSERAKLIKVSIGISASAMLL
LICIFVLLMECQKRKLRKEKKTFFQQNGGLLLYEQIMSKHVDTVRIFTREELENATNNFD
SSRELGRGGHGTVYKGILKDSREVAIKRSKIMNVAEKDEFVQEMIILSQINHRNVVKLLG
CCLEVEVPMLVYECIPNGSLFELMHGGYRKPHISLDARLRIAQESAEALAYLHSSASPPI
IHGDVKSPNILLGENYTAKVTDFGASRMVATDEIQFMTLLQGTIGYLDPEYIQERQLTDK
SDVYSFGVVLLELITRKFAIYSDGAGETKNLASSFLLAMKENSLQSILDQNILEFETELL
QEVAQLAKCCLSMRGEERPLMTEVAEKLKTIRSRWREQLTQNPINETECLLENPSWHYHL
SITGQHGSLMSLDLESGR
Download sequence
Identical sequences I1HW91
EG:BRADI3G01180.1 15368.BRADI3G01180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]