SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G01230.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G01230.1
Domain Number 1 Region: 704-990
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-63
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 288-586
Classification Level Classification E-value
Superfamily RNI-like 3.37e-60
Family Cyclin A/CDK2-associated p19, Skp2 0.049
Further Details:      
 
Domain Number 3 Region: 27-297
Classification Level Classification E-value
Superfamily L domain-like 2.83e-57
Family Polygalacturonase inhibiting protein PGIP 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G01230.1   Gene: BRADI3G01230   Transcript: BRADI3G01230.1
Sequence length 1033
Comment pep:novel chromosome:Brachy1.0:3:772659:776185:1 gene:BRADI3G01230 transcript:BRADI3G01230.1
Sequence
MAARVQTLLLAAVAVFFFSVSGVAGGDERAALLALKSGFIDPLGALADWKSSGGGSHCNW
TGVGCTAGGLVDSLDLAGKNLSGKVSGALLRLTSLAVLNLSSNAFSAALPKSFSPLPALR
ALDVSQNSFDGSFPSGLGASLVFVNGSGNNFVGALPLDLANATSLDTIDLRGCFFSGAIP
AAYGALTKLKFLGLSGNNIGGAIPPELGELEALESLVIGYNELEGAIPPELGNLASLQYL
DLAIGNLEGPIPPELGKMPSLASLFLYKNKLTGEIPAELGNVSSLAFLDLSDNLLSGAIP
PEVGKMSQLRVLNLMCNRLTGEVPAAVGAMAALEVLELWNNSLSGPLPAALGRSSPLQWV
DVSSNSFTGGIPPGICEGKALAKLIMFGNGFSGEIPAALALSCDSLVRVRLQGNRINGSI
PAGFGKLPWLQRLELAGNDLEGEIPVDLASSSSLSFVDVSRNRLQGTLPAGLFAVPSLQS
FMAAENLISGGIPDEFQECPALGALDLSGNRLTGGVPASLASCQRLVSLNLRRNGLSGAI
PPALGKMPALAVLDLSGNSLSGGIPESFGSSPALETMNLADNNLTGPVPANGVLRTINPG
ELAGNPGLCGAVLPLPPCSGSSSLRATARHGSSSSSTRSLRRAAIGLFVGTLAIVLAMFG
GWHVYYRRRYGGEEGELGGGAWSWRMTAFQRVGFGCGDVLACVKEANVVGMGATGVVYKA
ESLPRARAAIAVKKLWRPEGAPDAAAVDEVLKEVALLGRLRHRNIVRLLGYMRNDAGDAM
MLYEFMPNGSLWDALHGDSPPETKKTTTTKKKSTLLTDWASRYDVAAGVAQALAYLHHDC
HPPVLHRDIKSSNILLDADLQPRLADFGLARAIAAAAAPEPVSSVAGSYGYIAPEYGYTL
KVDAKSDIYSYGVVLMELITGRRAVEGQEDIVGWVREKIRANAMEEHLDPLHGGCAGVRE
EMLLALRVAVLCTAKLPRDRPSMRDVLTMLAEAKPRRKSGSAAVVPAPPPVAAAVVVDKD
RPVFSTTTEDDSV
Download sequence
Identical sequences I1HW96
EG:BRADI3G01230.1 XP_003570798.1.954 15368.BRADI3G01230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]