SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G01460.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G01460.1
Domain Number 1 Region: 12-280
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-54
Family Protein kinases, catalytic subunit 0.00052
Further Details:      
 
Domain Number 2 Region: 445-641,688-805
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 3.53e-20
Family DPP6 N-terminal domain-like 0.017
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G01460.1
Domain Number - Region: 771-807,836-919
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00102
Family YVTN repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G01460.1   Gene: BRADI3G01460   Transcript: BRADI3G01460.1
Sequence length 1027
Comment pep:novel chromosome:Brachy1.0:3:915343:921109:-1 gene:BRADI3G01460 transcript:BRADI3G01460.1
Sequence
MANEFQQTNATTREFTLQFLQQITDNFSEEHIIGRGGYGIGKLEDGEVIALKKLHQTMGL
DDTQFRNEFNHLMRTEHPNITRLVGYCYNQGHQRIKYNGEYIFANVEERVLCFEYLQGGS
LDKHISDPIYHLDLKPANILLDDKMIPKIGDFGLSRLFPLAQTYITTKIIGTRGYMPPEY
INRCEITLKFDVYSLGVIIIQIMAGYEGYSKFTDMSSQKFLKHVIENWDKQLQVTMSSHA
AEQVKKCIEIALRCVVAERENRPTIAEIVNELNKIDTADNLPAGQVINFRSKHAFRKNSN
SEPGGRIVFSRTNGTLVSFDIFSSPLSPSSTYELPLTDGVSYNYNGQAIPPAALKTLLKN
PKLADKADANDADIDAGNVSGLIFVSERDNGLETLYIALHFNAGSNILKVIALADIFGAA
DFSGVRLEDSGCIGGGYSVGCRTVDHCLIYVSTKEAAQERRSPWTVVYKTNLTTGKTERL
TPQGVFDLSPAVSPSGMMVAVASFESKSWNGELENLKTDIYVMNVDSEGQLGRKLLIKNG
GWPSWGSDNIIFFHRGTEKTLPSTSRMVVETAWGVFRYNISTQETVQVTPEELDAMTPAA
ISETKVAVATIRQNVPVQYRHIEIFDMNAASPVQITQKTSPECDHYNPFMLDGGGRIGYH
RSRTSRYHDKFYKLESPSKDVGLYRASGMFPAISKDGSKLAFVDDKSKVVWLADSQGLRI
VYEQTGSDSVFSPVWNQDSDKDILYICVGPSLESHRPLEIYSITNISSSDGGQEVRQLTC
GKFNNAFPSSSPDGGKLVFQSTRDFWPKKAEDRRKKHRNLHIMLNAAAGELDENCWVTRL
TKGSWTDTQCQWSPRGDWIVFLSTRDRQLTSNHADELEYPVGYLSVFLVKAYDPMVVVRI
MDSGADPVFSPDGRSIAVTADFSAVSVDPISLPKLARLCSNIFLVDINTDDDTEEKNKQE
DVVKWLFHHRMTHSRYGCGKLAWTTTRVDMDPEAPWKMMELGPNRNRLPKRGAVKRSIVS
SLLGFNL
Download sequence
Identical sequences I1HWC3
EG:BRADI3G01460.1 15368.BRADI3G01460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]