SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G01577.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G01577.1
Domain Number 1 Region: 784-1080
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-72
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 96-339,369-524
Classification Level Classification E-value
Superfamily L domain-like 9.3e-56
Family Polygalacturonase inhibiting protein PGIP 0.021
Further Details:      
 
Domain Number 3 Region: 568-682
Classification Level Classification E-value
Superfamily L domain-like 2.3e-20
Family Polygalacturonase inhibiting protein PGIP 0.0074
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G01577.1
Domain Number - Region: 708-737
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.05
Family DJ-1/PfpI 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G01577.1   Gene: BRADI3G01577   Transcript: BRADI3G01577.1
Sequence length 1099
Comment pep:novel chromosome:Brachy1.0:3:974993:978403:-1 gene:BRADI3G01577 transcript:BRADI3G01577.1
Sequence
MAAAAAAVAPLLLPAIVLLLSWCVSPAAAAQPCTANDLAALRGFSAGLDAPVSGWPPPAA
AAGAEEDDDCCSWPGVLCGGSPAIAVVELSLPNRTLRGQISGSLSGLPSLRVLNLSGNAL
RGPLPPEILLNLQSLQILDLSSNAINNLTLPSVVSTSLRVFNVSGNSLTGPHPVLPGAIN
LTVYEVSGNALTGAISAAALCRESPNLKILRLSMNRLDGLFPTGFSRCGSLAELALDGNG
AIHGSLPEDLFKLESLQTLILHGNSLSGAVSPLLRRLTSLVRLDISFNGFSGELPEAFDG
MAGTLQELSAAGNLVSGQLPATLSLCSRLRVLNLRNNSLSGAMAARLDGLLSPGRCGLVY
LDLGVNKFTGGIPAGLAGCSAMTALNLGRNSLAGEIPSSFAAAGAFPALSFLSLTGNGFS
NVTSALTTLQRLPKLTSLVLTKNFHGGEMMPALGIDGFANLEVLVIANCELSGEIPPWLT
GMKKLKVLDLSWNRLSGAIPPWLGEFERLFYLDVSNNSLRGEIPGTLASMPGLVAAGAGE
DDEEAAAVQDFPFFIRPSSSPAAKGRQYNQVSSFPPSLVLSRNGLAGRIPPAMGALTRVH
VVDLSWNKLSGPIPPELAGMTSLESFDASRNELTGPIPASLTGLSFLSHFSVAFNGLSGQ
IPLGGQFSTFSRADFEGNPLLCGRHVGRRCDRVAAPQQVINGSKDRRSANAGVVAAICVG
TVMLLAAGVVATWRMWSKRRQEDNARVAADDDDHDVDPEAARLSKMVLLFPDDDDETDGV
VKGTRTAMSVEEVVKATGNFAESRIVGCGGFGMVYRATLSDGCDVAVKRLSGDTWQAERE
FQAEVDALSHVSHHRNLVSLRGYCRHVGASGDYRLLIYPYMENGSLDHWLHERGSRDLPW
PTRMRIAVGAARGLAHLHDGPSRTRVLHRDVKSSNILLDGAMEARLGDFGLSRLARAHDD
THVTTDLVGTLGYIPPEYGHSAVATCRGDVYSMGVVLVELVTGRRPVDMAAGATRGGRRD
VTSWAVRMRREGKGEEVVDIDVARVEMHRDEAMRVLDVACACVREDPKARPTAQQVADRL
DAIADATDSSSSSGSSSDT
Download sequence
Identical sequences I1HWD8
EG:BRADI3G01577.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]