SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G01850.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G01850.1
Domain Number 1 Region: 298-571
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-82
Family Protein kinases, catalytic subunit 0.00001
Further Details:      
 
Domain Number 2 Region: 208-277
Classification Level Classification E-value
Superfamily ACT-like 0.000000119
Family IlvH-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G01850.1   Gene: BRADI3G01850   Transcript: BRADI3G01850.1
Sequence length 600
Comment pep:novel chromosome:Brachy1.0:3:1128750:1132858:-1 gene:BRADI3G01850 transcript:BRADI3G01850.1
Sequence
MAVEEPPPPQQQEGQRREVGAGGRRTDKQGRRLEVYNEVLARLRAAGEISPGFQDALWAH
FHRLPARYALDVNAERAEDVVTHQRLLQEARDPHRRPALSVRVVQVSRIIDGDMDDDSFD
PGMAASNHLPSICTWSLWISLNHPMSVLCFFSCMLSLDPVFGSFRAHPPPSFGSSSNLEA
LALEASEPDVASTTNNDDHSVHLVSRPMHEIALATIDKPKLLSKLTCLLGELGLDIQEAH
AFSTIDGYSLDVFVVTGWRLAGTKQLEEKLLQKLRNVEAQSWPVSSPSSPSLEGLQVGQN
LPSTSVKIPTDGADVWEINLKLLKFGNMVASGSNGDLYRGSYCSQDVAIKVVRPERISAD
MYRDFAQEVYIMRKVRHKNVVQFIGACTRQPNLYIITDFMSGGSVYDCLHKNSAFKLPEI
LRVATDISKGMNYLHQNNIIHRDLKTANLLMDENKVVKVADFGVSRVKDQSGVMTAETGT
YRWMAPEVIEHRPYDHKADVYSFGIVLWELLTGKIPYGQLTPMQAAVGVVQKGIRPIIPK
DTHPKLADLVQKCWHGDSAERPEFSQILEILQRLSKEVGTNANGLRKTKSGFLSALKRSH
Download sequence
Identical sequences I1HWH5
EG:BRADI3G01850.1 15368.BRADI3G01850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]