SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G03780.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G03780.1
Domain Number 1 Region: 24-326
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-100
Family Protein kinases, catalytic subunit 0.0000000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G03780.1   Gene: BRADI3G03780   Transcript: BRADI3G03780.1
Sequence length 369
Comment pep:novel chromosome:Brachy1.0:3:2521821:2525826:-1 gene:BRADI3G03780 transcript:BRADI3G03780.1
Sequence
MAMLVDPPNGMGNQGKHYYSMWQTLFEIDTKYVPIKPIGRGAYGIVCSSINRETNEKVAI
KKIHNVFDNRVDALRTLRELKLLRHLRHENVISLKDIMMPVQRRSFKDVYLVYELMDTDL
HQIIKSPQGLSNDHCQYFLFQLLRGLKYLHSAEILHRDLKPGNLLVNANCDLKICDFGLA
RTNSSKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMSESDLEFIDNPKARRYIKTLPYTPGVPLASMYPHAHPLAIDLLQKML
IFDPTKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDLDENISADMIREMMWQEMLHYH
PEAATAISM
Download sequence
Identical sequences I1HX65
15368.BRADI3G03780.2 EG:BRADI3G03780.1 EG:BRADI3G03780.2 NP_001266851.1.954 XP_010233641.1.954 XP_014755379.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]