SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G04070.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G04070.1
Domain Number 1 Region: 24-61
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000765
Family Protein kinases, catalytic subunit 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G04070.1   Gene: BRADI3G04070   Transcript: BRADI3G04070.1
Sequence length 74
Comment pep:novel chromosome:Brachy1.0:3:2744229:2744453:-1 gene:BRADI3G04070 transcript:BRADI3G04070.1
Sequence
MFCLNYLNISSASYIAGSTLDKDSSQELVSLIGYCKDKNHLALVYEYMPEGNLQDHLRGC
SSWLFKYIFLYQPM
Download sequence
Identical sequences I1HXA6
EG:BRADI3G04070.1 15368.BRADI3G04070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]