SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G04180.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G04180.1
Domain Number 1 Region: 740-1028
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-79
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 157-517
Classification Level Classification E-value
Superfamily RNI-like 1.57e-58
Family Rna1p (RanGAP1), N-terminal domain 0.068
Further Details:      
 
Domain Number 3 Region: 551-657
Classification Level Classification E-value
Superfamily L domain-like 4.85e-23
Family Polygalacturonase inhibiting protein PGIP 0.015
Further Details:      
 
Domain Number 4 Region: 81-196
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000918
Family Polygalacturonase inhibiting protein PGIP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G04180.1   Gene: BRADI3G04180   Transcript: BRADI3G04180.1
Sequence length 1043
Comment pep:novel chromosome:Brachy1.0:3:2860778:2864032:-1 gene:BRADI3G04180 transcript:BRADI3G04180.1
Sequence
MQTHHCSYWSRFPVAFIGLAVVLLISLPSPTSSCTEQEKSSLLQFLAELSQDGSLTVSWR
RNGTDCCTWEGIICGLNGTVTDVSLASRGLEGSISPFLGNLTGLSRLNLSHNLLSGGLPL
ELVSSSSITVLDVSFNHLTGGLRELPYSTPPRPLQVLNISSNLFTGRFPSTIWEVMKSLV
ALNASTNSFTGQIPTIPCVSAPSFAVLEISFNEFSGNVPTGLSNCSVLKVLSAGSNNLTG
TLPDELFKVTSLEHLSLPGNLLEGALNGIIRLTNLVTLDLGGNDLSGSIPDAIGELKRLE
ELHLEHNNMSGELPSSLSNCTSLITIDLKSNHFSGELTKVNFSSLPSLKNLDLLYNNFNG
TIPESIYTCRNLRALRLSSNNFHGQLSESIGNLKSLSFLSIVNSSLTNITRTLQILRSSR
SLTTLLIGFNFMHEAMPEEISTDGFENLQVLAINDCSLSGKIPHWLSKLTNLEMLFLDDN
QLTGPIPDWISSLNFLFYLDISNNSLTGEIPSALMDMPMLKSDKTAPKVFELPVYNKSPF
MQYLMPSAFPKILNLCMNNFTGLIPEKIGQLKALISLNLSSNTLSGEIPEPISNLTNLQV
LDLSGNHLTGTIPAALNNLHFLSKFNISNNDLEGPIPTVGQLSTFTSSSFDGNPKLCGHV
LLNNCSSAGTPSIIQKRHTKNSVFALAFGVFFGGVAIIFLLARLLVSLRGKKRSSNNDDI
EATSSNFNSEYSMVIVQRGKGEQNKLTVTDLLKATKNFDKEHIIGCGGYGLVYKAELPDG
SKVAIKKLNSEMCLMAREFSAEVDALSMAQHDNLVPLWGYCIQGDTRLLIYSYMENGSLD
DWLHNRDDDGGSFLDWPTRLKIAQGASRGLSYIHDVCKPHIVHRDIKSSNILLDKEFKAY
IADFGLSRLIFHNKTHVTTELVGTLGYIPPEYGQGWVATLRGDMYSFGVVLLELLTGRRP
VQICPRSKELVQWVQEMISKEKHIEVLDPTLQGAGHEEQMLKVLEVACRCVNRNPSLRPA
IQEVVSALSSRDGNLQKQNSVRI
Download sequence
Identical sequences I1HXB9
15368.BRADI3G04180.1 EG:BRADI3G04180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]