SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G04200.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G04200.1
Domain Number 1 Region: 99-130,162-512
Classification Level Classification E-value
Superfamily RNI-like 9.42e-59
Family Rna1p (RanGAP1), N-terminal domain 0.042
Further Details:      
 
Domain Number 2 Region: 688-952
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.83e-58
Family Protein kinases, catalytic subunit 0.00042
Further Details:      
 
Domain Number 3 Region: 544-607
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000272
Family Polygalacturonase inhibiting protein PGIP 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G04200.1   Gene: BRADI3G04200   Transcript: BRADI3G04200.1
Sequence length 966
Comment pep:novel chromosome:Brachy1.0:3:2872085:2877171:-1 gene:BRADI3G04200 transcript:BRADI3G04200.1
Sequence
MAIERKKQRLWEIHGEELQQSGLGHGHFQDALFEAVSKSIPYLCSCTPQEKGFLLQFING
LSHDGGLATSWQDVTDCCKWEGITCRQANTVTDVLLVSKGLEGYISESLGNLTGLKHLNL
SHNLLSGGLPLGLVSSHSITVLDVSFNLLNGALQELPTSISAQPLQVLKISSNLFTGEFP
STIWKAMENLILLNASNNSFSGGSIPPGIGDCSKLKVLRAGYNNLSGTIPDELFNTTLLE
YLSFPNNNLHGALGEARIINLSYLETLDLGGNKFNGEIPDSIGQLKKLKEFHLNNNKMSG
ELPSALSNCTNLITIDLKSNNFSGELTKVNFSKLPNLKTLDLYFNNFNGIVPESIYSCSN
LTALRLAGNKLHGQLSPQIGNLKDLTFMSLSHNSFQNITNALHILQSCRKLTTLLIAFNF
IGETIPEDENFDGLENLQVLGMEGCQLFGQIPLWISKLVNLEVLILSSNQLIGSIPAWIE
NLGKLFYLDISNNSLMAVIPTEMMDMAMLNSNKTEVHLDARFFELPVYAGPSLQYRVPIA
LRKLLNLSKNKLTGEIPLEIGQLKALLALNFSYNRLTGQIPQSICNLTNLQVLDLSSNNL
TVQLQYLYAPQNTENKAIFAIAFGVFFGGIAIPLLLGCLLLLIRKNGFTTKNRRGESGDV
EETSFYSRSEQTLVLMRMPHGKGEENKLKFTDILKATNNFDKENIIGCGGYGLVYKAELP
DGSKLAIKKLNGEICLMEREFSAEVDALSMAPHENLVPLLGYSIQGNSRLLIYSYMENGS
LDDWLHNRDDNASSFLDWPTRLKIAQGTSLGISYIHDVCNPQIVHRNIKSTRLVLPNKTH
VTTELVGTTGYIPPEYGQAWVATLRGDMYSLGVVLLELLTGMRPLPVLSKSKELVPWVLD
MRSQGKLVEVLDPTLRGTGYEDQMLKMLEAACKCIDHNQFMRPTIMEVVSCLASIDADSQ
MQNAKE
Download sequence
Identical sequences I1HXC1
15368.BRADI3G04200.1 EG:BRADI3G04200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]