SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G04567.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G04567.1
Domain Number 1 Region: 406-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-74
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 300-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000343
Family EGF-type module 0.0077
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G04567.1
Domain Number - Region: 265-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0788
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G04567.1   Gene: BRADI3G04567   Transcript: BRADI3G04567.1
Sequence length 709
Comment pep:novel chromosome:Brachy1.0:3:3136307:3139043:1 gene:BRADI3G04567 transcript:BRADI3G04567.1
Sequence
MAGPAVLLLQLWLAVAVKVLPLAAAAPGCRRRCGNVTVRYPFGIGDARCHRGEGRGFRLD
CDDSRRPPRLTVAGYGHEVVAISLPAAEATVLLNASRACYDDDDNRTSSRRRYDEHPMAL
NGSAFLFSSMKSKFVAIGCPDLAYFVDGGGYYVTGCMSVCRPSERALPGSCRGGDGCCQS
NIPLGLDSYRPYIRSFGGRRQQQQGTTTFMANSTRCAYAFMVDAWWFWYAGSRFNRTGDF
AVPVVLDWAIRDAPSCAAAAAAHACLSAHSVCLDSANGPGYVCNCSSGFQGNPYVLGGCQ
DVDECARSDLYPCYGVCVNTPGSHVCTCPNGRSGNATVQDGCNPKDEFTLALKAVTGVSI
GVFLVLLACFSAYLGLQKRRMLKAKQRFFEQNGGLLLQQQLGSLASSGVSFKIFSEDEIK
RATGSFDDARVLGRGGNGVVYRGVLVDGSTVAIKKSRVVDEKQLKEFSKEMLILSQINHR
NVVKLLGCCLEVEVPMLVYEYVPNGSLHRYLHGSSEGMGEPMPAGERLRIAAESAHALAY
MHSSASPPILHGDVKSANILLDGELAAKVSDFGASRLAPLDVAQVATLVQGTCGYLDPEY
LLTCQLTCKSDVYSFAVVLLELLTGRKAFWPDGPDEDDTSLAFSFVTAVQGGRHQEIMDA
HVRDKLGVEVLDDAAQLVIRCLSLAGEDRPTMKEVADKIEALRIRACRQ
Download sequence
Identical sequences I1HXG1
EG:BRADI3G04567.1 XP_003570960.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]