SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G04650.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G04650.2
Domain Number 1 Region: 9-39
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000412
Family CCCH zinc finger 0.0024
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G04650.2
Domain Number - Region: 150-235
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0102
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G04650.2   Gene: BRADI3G04650   Transcript: BRADI3G04650.2
Sequence length 367
Comment pep:novel chromosome:Brachy1.0:3:3188328:3194375:1 gene:BRADI3G04650 transcript:BRADI3G04650.2
Sequence
MLPPPRRGPAYKTKLCALFRNGHCDRESCSFAHGPDELRRPPSSRPSFPPHHAGRRDYRG
GDFRGRIERRFSPRRRHSPGRDFRGHRSLHNRRPTSRERESSFSRSPSRKSERRHDKKTD
DGETNSPKSLSVSDNSDMKKDKFSSGDEKEDHEKKLKQIRLDMEALREDKSHLEIVLDEK
IDEMRKISSKVNDLDQQLQREKNECHRMTSKMKKFIKAHGRFLKAQEELKRSQARFERLG
DLLASDILKRGANEEVSSVHADEDLNGSYERSPNTAVTKKRSIPYSTSDEAKAAKKRRDR
DSDTITRSDKYRSEGDATDFDKASKGSEATKSIYLKKRLWEDEKNKLGNVVSSADKYEDL
DEEVDVE
Download sequence
Identical sequences I1HXH2
XP_010233847.1.954 EG:BRADI3G04650.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]