SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G05670.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G05670.1
Domain Number 1 Region: 482-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.33e-55
Family Protein kinases, catalytic subunit 0.00031
Further Details:      
 
Domain Number 2 Region: 50-245
Classification Level Classification E-value
Superfamily L domain-like 8.32e-35
Family Polygalacturonase inhibiting protein PGIP 0.0073
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G05670.1
Domain Number - Region: 438-445
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000235
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G05670.1   Gene: BRADI3G05670   Transcript: BRADI3G05670.1
Sequence length 787
Comment pep:novel chromosome:Brachy1.0:3:3995755:4002961:-1 gene:BRADI3G05670 transcript:BRADI3G05670.1
Sequence
MRMGGGCFGRPAVRVMLQLMLLIAAAALLPRALALTDPADVAAINGLYVALGSPTLTGWT
ANGGDPCGEGWQGVICIGSNIDAINYVAATMEGQLGSLGNFTSITSINLSNNKITGTIPD
DLPVTLQSLFLSDNQLTGSIPASISKLRSLTAMSLNDNHLDGQLPDAFSLLVGLVNLDIS
SNNFSGPLPTSLGSLSSLTTLRMQNNQLSGTLNALQDLPLKDLNVENNLFSGPVPPKLLN
IPNLKKDGNPFNTSIAPSASPSLTPTGPTPTQTPSSPSSSSGTPSSNTPSNSSGGSTARD
SRSASSGKHKSSTLRTVGYVLLSIVLFIVVVLLVIFCLSKYQERQSRRERDYTTSQVGRV
RQRAEEPKVKQASVQSRNETKKDSAEVPNRKQAREINLAIPAAPDKPPEKRKEHVINLER
TESDIFAAAPLPPPPPPPPPPPPPPPPPLPSPPPPPPPVEKLIVNPVVRQEKRVVTPPRT
GPSTSATSFSVATLQQYTNSFEEGNLIRESRMGKVYLAELPEGRLLEIMKIDNANGRIPV
DDFLELVACISDIRHPNILELVGYCAEYEQRLLVYNHFSRKTLHDVLHEGDDLGSALSWN
ARLQVALGTAKALEYLHDTCEPPVVHQNFEPANVLLDNGFSVRVAECGLSELMLSGSVTQ
LSGRLRALLNYEAPEIQESGTFTDRSDVYSFGVVMLELLTGRKPYDSSRPRAEQHLVRWA
DSQLHDIDSLSKMVDPSIRGECSEKVLSRFADIISRCVPPEPEFRSPMSDIVQDLARMLS
DTGEESE
Download sequence
Identical sequences I1HXU5
XP_003570450.1.954 15368.BRADI3G05670.1 EG:BRADI3G05670.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]