SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G08070.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G08070.1
Domain Number 1 Region: 72-451
Classification Level Classification E-value
Superfamily L domain-like 1.33e-68
Family Polygalacturonase inhibiting protein PGIP 0.0053
Further Details:      
 
Domain Number 2 Region: 824-1143
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-67
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 3 Region: 512-765
Classification Level Classification E-value
Superfamily L domain-like 8.16e-60
Family Polygalacturonase inhibiting protein PGIP 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G08070.1   Gene: BRADI3G08070   Transcript: BRADI3G08070.1
Sequence length 1154
Comment pep:novel chromosome:Brachy1.0:3:6271173:6274797:1 gene:BRADI3G08070 transcript:BRADI3G08070.1
Sequence
MAAPAPPPMPLSLASIVVIFFLACSGAGQALPGFPKPANDAGTAADRHALLAFRSLVRSD
PSRTLASWSNSINNLSPCQWRGVSCGARGSRRGRVVALDLPGLGLLGTLTPALGNLTRLR
RLHLPDNRLHGALPRELGALRDLIHLDLSHNSIDSGIPQSLSGCKELKRVLLHTNKLQGQ
IPRQLVAALRSLEVLDLGQNTLTGSIPSDIGSLLNLRLLDLEANNLTGEIPWQIGNLASL
VRLSLGSNQLSGSIPASLGNLSALTALRASSNKLSGSIPLSLQHLASLSALDLGQNNLGG
PIPSWLGNLSSLTSLNLQSNGLVGRIPESIGNLQLLTAVSFAENRLAGPIPDAIGNLHAL
AELYLDNNELEGPLPLSIFNLSSLEMLNVQSNNLTGAFPLGMGNTMTNLQEFLVSKNQFH
GVIPPSLCNASMLQMVQTVDNFLSGTIPGCLGSRQEMLSAVNFVGNQLEATNDADWAFLA
SLTNCSNMILLDVSINRLQGVLPKSIGNLSTQMTYLGISSNSIRGTITEAIGNLINLDEL
DMDNNLLEGTIPASLGKLEKLNHLDLSNNNLSGSIPVGIGNLTKLTILFLSTNTLSGTIP
SAISNCPLEALDLSYNHLSGPMPKELFLISTLSSFMYLAHNSLSGTFPSETGNLKNLAEL
DISDNMISGKIPTTIGECQSLQYLNVSGNFLKGTIPLSLGQLRGLLVLDLSQNNLSGSIP
NFLCSMKGLASLNLSFNHFEGEVPKDGIFRNATATSIKGNNALCGGVPQLKLKTCSSLAK
RKISSKSVIAIISVGSAILLIILFILFMLCRRNKLRRTNTQTSLSNEKHMRVSYAELAKA
TDGFTSENLIGVGSFSAVYKGRMEISGQQVVIAVKVLNLQQAGALRSFDAECEALRCIRH
RNLVKVITVCSSIDSRGADFKALVFEFLPNGNLDHWLHEHPEEDGEPKVLDLTERLQIAM
DVASALDYLHHHKPFPIVHCDLKPSNILLDNDMVAHVGDFGLARFLHEEQSDKLETPTSR
NAIRGTIGYVAPEYGLGSEASIHGDVYSYGILLLEMFTGKRPTGSEFGEELSLHKDVQMA
LPHQAANVIDQDLLKAASGNGKGTAGDYQKTEDCIISILQVGISCLKETPSDRIQIGDAL
RKLQATKDTFYTHE
Download sequence
Identical sequences I1HYR1
EG:BRADI3G08070.1 XP_010236334.1.954 15368.BRADI3G08070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]