SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G08075.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G08075.1
Domain Number 1 Region: 87-430
Classification Level Classification E-value
Superfamily RNI-like 4e-67
Family Cyclin A/CDK2-associated p19, Skp2 0.076
Further Details:      
 
Domain Number 2 Region: 838-1158
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-67
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 3 Region: 498-776
Classification Level Classification E-value
Superfamily L domain-like 1.43e-55
Family Polygalacturonase inhibiting protein PGIP 0.00033
Further Details:      
 
Domain Number 4 Region: 416-513
Classification Level Classification E-value
Superfamily L domain-like 0.00000816
Family Internalin LRR domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G08075.1   Gene: BRADI3G08075   Transcript: BRADI3G08075.1
Sequence length 1177
Comment pep:novel chromosome:Brachy1.0:3:6276195:6280336:1 gene:BRADI3G08075 transcript:BRADI3G08075.1
Sequence
MAATWYSALLLLLLLTTVATDGQPVSVANTEAPADDHLALVSFKSLITSDPSSALASWGG
NRSVPLCQWRGVMCGMKGHRRGRVVALDLSNLGLSGAIAPSLGNLTYLRKIQLPMNRLFG
TIPSELGRLLDLRHVNLSYNSLEGGIPASLSQCQHLENISLAYNNLSGVIPPAIGDLPSL
RHVQMQYNMLYGTIPRSLGSLRGLKVLHVYNNKLTGRIPSEIGNLTNLASLNLNYNHLTG
SIPSSLRNLQRIQNLQVRGNQLTGPIPLFFGNLSVLTILNLGTNRFEGEIVPLQALSSLS
VLILQENNLHGGLPSWLGNLSSLVYLSLGGNSLTGTIPESLGNLQMLSGLVLAENNLTGS
IPSSLGNLRALSDFYLDKNQLTGQVPSSIFNMSSLRIFNLQFNQLTGSLPTRKEVNFPAL
DIFNVGENSFQGVIPPWLCNCSMLSTIAVEVNMISGTVPPCLGVIQKRLSVLTLGQNQLQ
ADEDNGWDFISSLTNSSHLKILDFRINKFRGMLPNSVANLSTDLQAFDISNNMISGNIPK
GIGNLVNLSYLLMNINSLEGTIPSSLGRLQMLSYLDLGMNNLSGQIPRSLGNLTLLNKLY
LGHNSLNGPVPSSLRGCPLEVLDVQHNMLSGPIPKEVFLISTLSNFMYFQSNLFSGSLPL
EIGSLKHITDIDLSDNQISGEIPASIGGCQSLQFLKIQKNYLQGTIPASMGQLKGLQILD
LSRNNLSGEIPGFLGRMKGLGSLNLSFNNFDGEVPKDGIFLDLNAITIEGNQGLCGGIPG
MKLSPCSTHTTKKLSLKVILIISVSSAVLLLIVLFALFAFWHSWSKPQQANKVLSLIDDL
HIRVSYVELANATNGFASENLIGVGSFGSVYKGRMIIQAQHAIVAVKVLNLQQPGASRSF
VAECETLRCVRHRNLLKILTVCSSMDFQNHDFKALVYEFLPNGNLDQWIHKPPEENGEDK
VLNLTRRLSIAIDVASALDYLHQHRPLPVIHCDLKPSNILLDNNMVAHVGDFGLARALHQ
DQSDLLEKSSGWATMRGTVGYAAPEYGLGNEVSIMGDVYSYGVLLLEMFTGKRPTDSEFG
EALGLHKYVQMALPDRVINIVDRQLLSKDMDGEERTSNPDRGEREIACITSVLHIGLSCS
KETPTDRMQIGDALKELMTIRDKFRINSLSSDEVTSN
Download sequence
Identical sequences I1HYR2
EG:BRADI3G08075.1 XP_014757154.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]