SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G08880.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G08880.1
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily RING/U-box 0.000000598
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G08880.1
Domain Number - Region: 106-181
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000178
Family Myosin rod fragments 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G08880.1   Gene: BRADI3G08880   Transcript: BRADI3G08880.1
Sequence length 295
Comment pep:novel chromosome:Brachy1.0:3:6970519:6973033:-1 gene:BRADI3G08880 transcript:BRADI3G08880.1
Sequence
MKCNACWREMEGQAISTTCGHLLCPEDAKKILSADGACPICDQVLSKSHMKPIDINPSDE
WTNMSMVGISPQILMKSAYRSVMFYIGQKELEMQYKMNRVLGQCRQKCEHIQAKFTEKLE
EVHTAYQKMGKRCQLMEQEIENLTRDKQELQEKFAEKSRQKRKLDEMYDQLRNEYESVKR
SAIQPANNYFSRAQPDLFSGMPNILDSGNPLRQGRREEGWAPQPRQRRENSGPFELSAGS
PGHTAAPPMDMRPRQPARSTFGANMNNSSAALRNMIISPMKRPQLSRNRPQLFTL
Download sequence
Identical sequences I1HZ17
XP_010234083.1.954 EG:BRADI3G08880.1 15368.BRADI3G08880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]