SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G09005.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G09005.1
Domain Number 1 Region: 505-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-76
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 104-227
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-22
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G09005.1
Domain Number - Region: 392-432
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0628
Family Pan module (APPLE domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G09005.1   Gene: BRADI3G09005   Transcript: BRADI3G09005.1
Sequence length 827
Comment pep:novel chromosome:Brachy1.0:3:7103036:7105567:1 gene:BRADI3G09005 transcript:BRADI3G09005.1
Sequence
MLLLLLFALSVPSSQAWSFDYPSPIANLPSLWSNNNATIPYSATYTSGLTTRAILVRQNP
AGYGPSFACGFICTAPCDTFLFAVFSVFIGENTNNPALNASATPRVIWTANRRRPVKENA
SLQINRDGDLVLRDFDGSLVWSTTTSGSTVVGMNLAQTGNLILFDMVGKTVWESFEHPDD
TLLIGQSLRQGKRLTSASANWTQGQFYLTVLDHGLHAFVDGDPPQFYYQKRFNVTDAMAH
SNMNISSSDEAKDSMVYISFLQGSLTAFASFNNTDIKLFDMSLPWRSSAQLMSLEDDGHL
RVYGWDGISWEPLADVLDVQPDECAYPTVCGEYGICSQGYCSCPSRNSGDELFRHLDDRQ
PNLGCSPAIPLSCDLIQYQQLLPLADVTYFNFAYNWTTHEESCKEACLKACTCKAVFFRY
QNDTYGSCYLMPKIFSFMHYKPEKIGYNLSAYIKVQMLPPPSASKDLGATAYHVGVPVLV
AFIGVLILIIKRIISKKMQEDDPFKGIPGMPTRFSYKQLREATNNFSKKLGQGGFGPVYE
GKLGNVKIAVKCLRDMGHGKEEFMAEVITIGSVHHINLVRLIGYCSDKLHRLLVYEHMCN
GSLDKWIFSKSQSDSLSWASRYKIIIDIAKGLAYLHEECRQKIVHLDIKPGNILLDENFN
AKISDFGLAKLIDRDQSHVMTKVRGTRGYLAPEWLTSTITEKADIYSFGVVVLEIVSRRK
ILDSSQPEGSTNLINLLQEKIKVGQVLDIVENQDEDMQLHGAEMIEVIKLAIWCLQRECS
KRPAMSQVVKVLEGAMDAERTAGSETTSRDYIFNASSPLTPVQVSAR
Download sequence
Identical sequences I1HZ32
XP_003571152.2.954 EG:BRADI3G09005.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]