SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G09060.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G09060.1
Domain Number 1 Region: 283-575
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-76
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 41-204
Classification Level Classification E-value
Superfamily L domain-like 7.48e-38
Family Polygalacturonase inhibiting protein PGIP 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G09060.1   Gene: BRADI3G09060   Transcript: BRADI3G09060.1
Sequence length 625
Comment pep:novel chromosome:Brachy1.0:3:7156260:7162428:-1 gene:BRADI3G09060 transcript:BRADI3G09060.1
Sequence
MARLPLAAGAGAVGVVVAAWLLAAGGVAAGDPPLSPKGLNYEVAALMAVKNRMRDEKGVM
AGWDINSVDPCTWSMVACSPEGFVVSLQMANNGLSGALSPSIGNLSYLQTMLLQNNKISG
GIPPEIGKLANLKALDISGNQFVGEIPSSLGQLTRLNYLRLDKNNLSGQIPTDVAKLPGL
TFLDISYNNLSGPVPKIYAHDYSLVGNKFLCNSSSLHGCTDLKGVTNDTTSRTSNKTKNH
HQLALAISLSVICATIFALFFACWLNYCRWRLPFASSDQDLDIEMGHLKHFSFHDLQNAT
DNFNSKNILGQGGFGVVYKGCFRNGTLVAVKRLKDPDVTGEVQFQTEVELIGLAVHRNLL
RLYGFCMTSKERLLVYPYMPNGSVADRLREYHRGKPSLDWSKRMRIAIGAARGLLYLHEQ
CNPKIIHRDVKAANILLDESFEAVVGDFGLAKLLDRQDSHVTTAVRGTIGHIAPEYLSTG
QSSEKTDVYGFGILLLELITGPKTLSNGHGQSQKGMILDWVRELKEEKKLDKLVDRDLKD
SFDVAELECSVDVILQCTLTNPILRPKMSEVLHALESNVALAENGVDMHREALPYGGSCS
FSVRHEDPHDSSSFIIEPIELSGPR
Download sequence
Identical sequences I1HZ44
EG:BRADI3G09060.1 XP_003571896.1.954 15368.BRADI3G09060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]