SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G09150.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G09150.1
Domain Number 1 Region: 368-633
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-38
Family Protein kinases, catalytic subunit 0.0019
Further Details:      
 
Domain Number 2 Region: 57-230
Classification Level Classification E-value
Superfamily L domain-like 1.09e-29
Family Polygalacturonase inhibiting protein PGIP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G09150.1   Gene: BRADI3G09150   Transcript: BRADI3G09150.1
Sequence length 641
Comment pep:novel chromosome:Brachy1.0:3:7241572:7244876:-1 gene:BRADI3G09150 transcript:BRADI3G09150.1
Sequence
MPRRPRHYARSLLPLLFLPAIIIAATSTATTAASASYNRTSNCTLLPDADIVRKAFLDVI
NFRLPRHGRSACRPVRRLRFPSSNLTGVPRWDELANLSSLLTLNLSGNSLEGELRGAFWR
APSLRAVDLSGNRLGGALRFEPSTRLRSLDVSGNRFTSVEGVGLLHGLESLDLSGNVIGK
VPEGLPRLGAQVRRLDLSRNSMAGRFPDDFPRLDGVEFLNISHNNFSGMVDARIVRKFGP
SAFLQAGNALLVVEDLEPAPATKGRKKHRRVVLIVVVVVAVATVAFLAGCVACGLNLKRG
KKRGKKKDKDGKAAAATWDEDEVAVGAVKVAATAPVVVLERPLMELTLADLAAATSGFGR
ESQLADAGGRSGAAYRAVLPGDLHVVVRVVEGPVAGIGEDDDAAATAAAFRELARLRHPN
ILPLLGYCIAGTQKLLLYEYTEKGDLHRWLHELPAGSMDIQESGIIIDPTWDATEDTSNK
PIGDWPTRYQLILGIARGLAFLHQGSSGRPIVHGHLVPTNILLGDDLEPRISDFVHPGSN
ETPEGDVYGFGVLVFELVTGQAKWDEATVSWARGVIRNKKGANIVDARLREETETETRRT
EREAEECLQVGLLCTAHSPEKRPTMQQVVGVLKDVRPAPAD
Download sequence
Identical sequences I1HZ55
15368.BRADI3G09150.1 EG:BRADI3G09150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]