SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G10350.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G10350.1
Domain Number 1 Region: 88-261,302-398
Classification Level Classification E-value
Superfamily PP2C-like 2.49e-53
Family PP2C-like 0.0013
Further Details:      
 
Domain Number 2 Region: 763-1059
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-45
Family Protein kinases, catalytic subunit 0.0000194
Further Details:      
 
Domain Number 3 Region: 467-598
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-26
Family cAMP-binding domain 0.00035
Further Details:      
 
Domain Number 4 Region: 607-743
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.22e-17
Family cAMP-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G10350.1   Gene: BRADI3G10350   Transcript: BRADI3G10350.1
Sequence length 1087
Comment pep:novel chromosome:Brachy1.0:3:8534900:8542697:1 gene:BRADI3G10350 transcript:BRADI3G10350.1
Sequence
MGCSPSKDCSCSHFKGCLHSHGCFRQTPDSPRESREKSGRGRGKTDSSASDGSSDDLEGE
DDGLNQMNITRESNVGINRLSRVSSQFLPPEGSRKVRVPLGNYDLRYSYLSQRGYYPESL
DKPNQDSFCIHTPFGTSPDDHFFGVFDGHGEYGAQCSQFVKRRLCENLLRDSRFRTDAVQ
ALHSAFLATNSQLHADSLDDSMSGTTAITILVRGKTLYVANSGDSRAVIAEKRGEDIVAV
DLSIDQTPFRADEVERVKECGARVLTLDQIEGLKNPDLQCWGTEENDDGDPPRLWVESGM
YPGTAFTRSIGDSVAESIGVVANPEIFILELTAIHPFFVIASDGVFEFLSSQTVVDMIAK
YKDPRDACAAIVAESYRLWLQYETRTDDITIILVHINGLTDVGPTQTIMKVSLQPSQQVL
ELAGSESPSVVSMNPNKQRSTYDLSRTRLRALESSLGNGQLWAPPSPSHRKTWEEQAHIE
RILHDHFLFRKLTDSQCNVLLDCMQRLEAKPGDIVVQQGGEGDCFYVVGSGEFEVLAIQE
EDGKEMTKVLHRYTADKQSSFGELALMYNKPLQSSVRAVTSGTLWALKREDFRGILMSEF
SNISSLKLLRSVELFTKLTVVQLSQLAESLVEVSFADGQVIVEKDDEVSNLYIIQRGRVR
LIVAADQLNSDAWDLLSAHTKQVQQSQENGNYVVEIDEGGHFGEWTLIGETIAFTAISVG
DVICSTIAKEKFDLTVGSLPKLSQPDSKLKDSLIPKEHQHSAEEDFSFRRVHLSDLEWKT
CIYAADCSEIGLVQVRGSDKIKSFKRFYIKRVKDLRKEAQVFQEKDIMKSLSQTACVPEV
LCTCADQSYLGILLNCCLCCSLASILSTPLSESSARFYAASVVVSLEELHQRCILYRGVS
ADILMLDRSGHLQIVDFRFAKKLEGERTYTVCGIADSLAPEIVLGKGHGFAADWWALGVL
IYFMLQSDMPFGSWRESELEPFAKIAKGHLIMPSTFSVEVVDLITKLLVVDENARLGTNG
ADAVKKHPWFDGIDWKQIADGTLTVPQEISDRIASYVETLQEDLTGSPSMMTEDPADLAV
PEWVKDW
Download sequence
Identical sequences I1HZJ6
XP_003572516.1.954 EG:BRADI3G10350.1 15368.BRADI3G10350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]