SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G10860.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G10860.1
Domain Number 1 Region: 405-521
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.18e-22
Family Protein kinases, catalytic subunit 0.0019
Further Details:      
 
Domain Number 2 Region: 264-350
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000111
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G10860.1
Domain Number - Region: 547-585
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0329
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G10860.1   Gene: BRADI3G10860   Transcript: BRADI3G10860.1
Sequence length 631
Comment pep:novel chromosome:Brachy1.0:3:9106006:9111182:1 gene:BRADI3G10860 transcript:BRADI3G10860.1
Sequence
MAKACLLPVLLMAALAATVESLSTLNPGCQSSCGGVDVPYPFGIGTDRGGAECFRPGFRI
DCVNNTPFLTGTTQVIPVLQLSVMPRPEARVMLPVAWICYNTSTWSEVTGEYHGVVDFNS
AGVYRISNSSNELFVLGCNTIIFINSGRPSRGYDHSYHAGCINYCKDLQSVQDGACSGIG
CCHVDIPPGLTDNWMRFYSFSHQGMEFSPCEYAFIVEKGNYSFLAADLHMDAKQRKMPLR
LDWAIRDGNINSTDSLTCSQAANRQEYTCVSKNSECVDATNGPGYFCTCKKGYEGNPYLR
DGCINIIECDRLAEFPCNGKCEDTEGSYICTCHPGHTSNGDPKIDPCHPTFTLAAKLALG
ITLGVSFLIVFLLLAFIMIQKRKLDELFEKNGGKILQNVKGLTIFTKDGLKKITKDNSDF
LGNGSFGKVYKGTLSDNTLVAVKASIKVDEATKAEFTEEVEIQTYMIHKNILKLIGCCLE
VDVPVLVYEFAANGSLQDTLHGNRTQKITLDSRLDIAIGLIMEYQKVYEKERSGRSMFDK
DIANEEDMVILEEIGKLALDCLKENIEDRPDMTEVAERLVMIRRDKKFGKKNNRKAHHIG
NITMDDSPSSTEVRAIFSVASMANHNFSGNY
Download sequence
Identical sequences I1HZQ8
EG:BRADI3G10860.1 15368.BRADI3G10860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]