SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G11377.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G11377.1
Domain Number 1 Region: 332-667
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 9.42e-52
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0056
Further Details:      
 
Domain Number 2 Region: 56-329
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.19e-50
Family G proteins 0.00000781
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G11377.1
Domain Number - Region: 705-793
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G11377.1   Gene: BRADI3G11377   Transcript: BRADI3G11377.1
Sequence length 1086
Comment pep:novel chromosome:Brachy1.0:3:9825744:9836906:1 gene:BRADI3G11377 transcript:BRADI3G11377.1
Sequence
MMQMLGLRGSASKERDRSHRGDALPASPSAATPGSPWTPSSASSPRSPFAGGGGGGRPLR
LVYCDERGKFRMDPEALSVLQLVKGPVGVVSVCGRARQGKSFILNQLLGRSSGFQVASTH
RPCTKGLWMWSSPIKRTALDGTEYSLLLLDTEGIDAYDQTGTYSIQIFSLAVLLSSMFIY
NQMGGIDEAALDRLSLVTEMTKHIRVRANGGRSTASELGQFSPIFTWLLRDFYLDLVEND
RKITPRDYLEIALKPLEGRGKDLSSKNEIRESIRALFPDRECFTLVRPLNNENELQRLDQ
IPLEKLRPEFQSGLDELTKFIFARTRPKQVAGTVMTGPVLAGVTQSFLDAINNGAVPTIS
SSWQSVEEAECHRAYDLAVEVYMSSFNRSKLAEEDALRDAHDTALRKALDAYNTAAVGTG
TSRIQYEKVLNNFCRKTFQDYKRNAFLEADKQCSDAVHNMEKKLRAACSAPGAKVACMIQ
VLETLLREYESSCSGPGKWRILAAFLRQCLEGPILDLCLKLINEAESERTSFARRCHSNE
DQLELLKKQLEANEAHKSEYLKRYEAAISEKQRVSDDLSGHLANLRTKCSTLEERCLSIS
KELDLVRHECSDWRAKYDQSVSQNKSEQGRFVAQLASLESRYSSAEGKLEAAREQAASAQ
DEAAEWRRKYESAAAQAKTALERLASVQEQINKIAQERESAIRAEFAAHLEEKDEEMKRI
IARIRHAESEESVLVERLQAAESRTKSQSKETVVLKNEIKELTSKLEFLRDRALSYEKQA
RMLEQEKNHLQEKFLSECKKYDEIEERYKAAEKDAIKATELAKVAQTESIAAQKEKDETQ
CLSIEKLAVIERIQRQVDRLEQEKVKLVDEVQRMRKSETDALSKVALLESRVDEREKEID
DLLSRSNEQRSSTVHVLESLLANERAAKAEANKRAEALSLQLQSTQSKLDVLHQELTSIR
IVETGLDSKLRSTTYGKRMRQNEVGTESVQDMDIDQPERSRKRSKSNTSLLKHLQTEGGG
SVHMGEDSVSVSTDTRDCTPEGYKKFTIPKLKDELTKHGFGAQLLELRSPNKKDILALYK
KHVLGQ
Download sequence
Identical sequences I1HZX1
EG:BRADI3G11377.1 XP_003573192.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]