SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G12497.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G12497.1
Domain Number 1 Region: 63-197
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0000578
Family CAT-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G12497.1   Gene: BRADI3G12497   Transcript: BRADI3G12497.1
Sequence length 450
Comment pep:novel chromosome:Brachy1.0:3:11181143:11182814:-1 gene:BRADI3G12497 transcript:BRADI3G12497.1
Sequence
MAEAASGNGTTAAVTVTGSRTVAPSKRKPTTLATFDLPYITFYYNQKLLLYRLPSAVDFH
DAAARMAASLADALALFHPLAGRILLQDVDKDGGGVLVVDGEEGAEVFEAAAEGVSLAEL
AGEDCAEELMQRLVPYTGVMNLEGLRRPLLAVQLTKLRDGMAVGCAFNHAVLDGTATWHF
MTSWAELCRGLTSPTTLPVHDRSAARSTKVRLTLPPSAAAHEATDPNGPKPPLVARVFSF
PASTVARIKAQANSSLLPGTTKPFSTFQSLGGHVWRAVSKARLLGPSDITVFAVFADCRA
RLSPPVPASYFGNLIQAVFTGIPAGMLLGSPPQLAAGMLQKAIDEHDAAAVTRRLEEYEA
APKLFHYSDAGPNCVAVGSSPRFKVYGVDFGFGRPERVRSGGNNKFDGMVYLYPGRGEEE
GGIDVELALQPEPMKRLLEDPEFLNFAADA
Download sequence
Identical sequences I1I019
XP_003571265.3.954 EG:BRADI3G12497.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]