SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G13060.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G13060.1
Domain Number 1 Region: 292-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-73
Family Protein kinases, catalytic subunit 0.0000215
Further Details:      
 
Domain Number 2 Region: 157-220
Classification Level Classification E-value
Superfamily ACT-like 0.000000000237
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G13060.1   Gene: BRADI3G13060   Transcript: BRADI3G13060.1
Sequence length 554
Comment pep:novel chromosome:Brachy1.0:3:11666043:11671851:-1 gene:BRADI3G13060 transcript:BRADI3G13060.1
Sequence
MAPPPLLLLEEGTGESSSPPRDATKSPHSDLRRKIYEKLVKAGKQGGLDDSSFREMLYNH
FDKLPRRYLIDLGEKKAEDVLLHRSVLQECALPGSSGAVIRARFLECIPDKSDCEGTNPE
SDQCQKLEDLTLEKKHGADNTGSVSASSRDSNHKLVHEIIFSCVDRPKLLSQLTALLSEI
GLNIREAHVYSTTDGFCLDVFVVEGWMTERTDELIARLKDKLMQQNGAPSSSTDSSSSVK
IRELRQQVGDSEIDWSMVEKGERIASGSTADLKSHSRINYPANLIHFLFHRYRGTYKGSD
VAIKMLRVAHLNNASEVEFLQEVLILRSVNHENILQFYGASTRHPNCCIVTEYMPEGNLY
EFLHKQNDLLEINEILRIAISISKGMEYLHRNNIIHRDLKTANVLKGYGQVLKIADFGVS
RIGSQEGQMTAETGTYRWMAPEIIDHKPYDHKADVFSFAIVLWELITLKVPYDDMTPLQA
ALGVRQGFRLQIPSGTHPGLSKLIRQCWDEDPEIRPAFGEIITQLEDMLQQVPVETPKGG
HHRRYRAKKIQKKS
Download sequence
Identical sequences I1I0A1
15368.BRADI3G13060.1 EG:BRADI3G13060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]