SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G13387.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G13387.1
Domain Number 1 Region: 464-804
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-68
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 81-309
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.24e-19
Family beta-lactamase inhibitor protein-II, BLIP-II 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G13387.1   Gene: BRADI3G13387   Transcript: BRADI3G13387.1
Sequence length 894
Comment pep:novel chromosome:Brachy1.0:3:11847293:11849977:1 gene:BRADI3G13387 transcript:BRADI3G13387.1
Sequence
MSRRLKDFVTTTALFFFLLFVFLGSGAAAGPSKRQFSTVAITHTSNSTIVCALVLDKDDS
GASGGAKLRCVSLPSGEVTTYPSADVPFNAIAAGKDFLCGLMAPTGGHAAMRWWSFSEEK
LANRSRPVGRRLYWGASLRSMAAGGAHACGLSDDHDPTCWEWPSLSLPKGLDFSLIALGH
DFLCGVLKNDSADLRCFGTTGPTSSSSSSFMALAAGRRHACAVDDKGRLVCWGEGNPAVV
EGELPKEMAAMALGHDTTCILGGDGRVRCWGVEVPPELRTTAFVAVEADGGAVCGVVAVN
YAVVCWSNDGRFAAGKKRSRVVFNETMPGSCAPRKSCECDVVSGSGALCGTGGGNGAAGE
LAVCQPCKVALSRLVISNNGRTAADGSSESEKKKMPLVVGLSVSGAVVLAVAGMAVVFVF
KRKRPASEKKKSVRLGESSSTGLCRDIESSMAVSPASEKNKHPQTNNRPLGCEEFTLKDL
SRLTNGFAEEAKIGAGSFGSVYRATLADGREVAIKRAERRPNSSATGGGERRRQRRRFDA
ERAFRSELRLLSRVNHRNLVSLLGFCEERGERILVFEFMPHGALHDHLHADPAGAGEDNH
SASPLFTSWEARLRVALDAARGVEYLHCYAVPAIIHRDIKPSNILLDADWTAKVSDFGLS
LVSSNSGSTATTTTTTTASTSSASMATAGTVGYMDPEYYRLQELTERSDVYSFGVVLLEL
VTGRKAIHRDRSSPEGSGSPRNVIEFAVPAVEAGEVEKILDGRVPPPKGHEVEAVARVAK
IGAECVRPRGRGRPVMSEVVAELEWAVTLCEECVVRNNSGGRNYSSSDMSRSRNGGGGGG
DISRSESDEPSPYHTRELEFSFHSGPSASAVFSGSGAGAGDGGGAAHGRSYSTM
Download sequence
Identical sequences I1I0D7
EG:BRADI3G13387.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]