SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G13980.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G13980.1
Domain Number 1 Region: 253-349
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-32
Family Ribosomal protein S14 0.0009
Further Details:      
 
Domain Number 2 Region: 46-149
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.46e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00013
Further Details:      
 
Domain Number 3 Region: 150-227
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 3.49e-19
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G13980.1   Gene: BRADI3G13980   Transcript: BRADI3G13980.1
Sequence length 349
Comment pep:novel chromosome:Brachy1.0:3:12425774:12428451:-1 gene:BRADI3G13980 transcript:BRADI3G13980.1
Sequence
MAAAALLRRSQTAARALLSPAPLSSRLVASKPHSSSPAPPPPSASTKTFSIYRWDPDSPS
TKPHLKDYKVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGLAC
LTKISSESKGASTISPLPHMFVVKDLVVDMTNFYNQYKSVEPWLKRKDPPSPEGKEIPQT
KADRAKLDGMYECILCACCSTSCPSYWWNPEEYLGPAALLHANRLPLWGTLIKPKPSMFM
HVQARGYHGVSENRNMRDHKRRLLAAKYELRGKLYKSVCRDPDLPLEMRDKFRYKLSKLP
RNSNMTRLRNRCIFTGRSRGVYKKFRMSRIVFRTLANKGEVMGVKKASW
Download sequence
Identical sequences I1I0K5
XP_003573313.1.954 EG:BRADI3G13980.1 15368.BRADI3G13980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]