SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G15457.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G15457.1
Domain Number 1 Region: 320-503
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-42
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G15457.1
Domain Number - Region: 216-247
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0145
Family Anti-platelet protein 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G15457.1   Gene: BRADI3G15457   Transcript: BRADI3G15457.1
Sequence length 543
Comment pep:novel chromosome:Brachy1.0:3:13768087:13771027:-1 gene:BRADI3G15457 transcript:BRADI3G15457.1
Sequence
MAELDHPTNTLLPGMNLRLSHKMHPLQLLVSWKGLDDPSPGDFSYGADPDNLMQRFIWHG
SRPYQRSPVWTNYLQPVNYMDGISKPTVSLALHHAGDEVYMSFGMPTGSFILLVRMEIDY
SGKVNILSWENNMSVWKALYTEHVYGCNMYGYCCPYGYCDNTEILPVCKCPDGFEPRDDK
GWIAGRFSQGCCRKEVLRCTHGDVFLSFPGMKVPDKFLPVRSRSFDECMEECRSNCSCVA
YAYSSMSDMDIDGDDIRCLVWMGDLIDMENFTQGGENLYVRTNRSRGKKRGLEIVLPVIS
SLLILILMGLIWICGLRDDRRKSLLNWPTRFKIITGVARGLVYLHQESRLMMIHRDPKAS
NILLDAEMIPKISDFGTARIFGVNEQQEHTNRVVGTFGCMSPEYAMEGIISVKSDVYSFG
VLLLEIVSGLKISTTDPTTHSHNLIDYAWTLWKNGSILNLVDPSIAASCSHDEALRCIHI
GLLSVQDNPNARPLMSWVLSSLDNGGIELPQPKESAYFHRNYGTDGAEESHVNNMSLGNL
KGR
Download sequence
Identical sequences I1I134
EG:BRADI3G15457.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]