SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G15480.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G15480.1
Domain Number 1 Region: 40-132,164-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.4e-27
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G15480.1
Domain Number - Region: 334-389
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000341
Family Hairpin loop containing domain 0.049
Further Details:      
 
Domain Number - Region: 267-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000372
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G15480.1   Gene: BRADI3G15480   Transcript: BRADI3G15480.1
Sequence length 430
Comment pep:novel chromosome:Brachy1.0:3:13777721:13779701:-1 gene:BRADI3G15480 transcript:BRADI3G15480.1
Sequence
MVNRLLPDKPLSAGTTLISDDGTFALGFFSPSSSTTTKRYYVGIWYKDIPKDNVVWVANR
ATPITNPSSATLALINGSNLAVSDTNRKLLWMTNTSTASNSSSEATLDNNGNFVLRSSQG
TILWQSFDYPTDTLLPGMNLRITHNTHALQRLISWKNPQDPSPGNFSYGADPDFFLQRFI
WNGSRSYRRSPVWNNYLVVGQYLETIKSTIYFTLHHIDDEVYISFGLPVPSVSSLVLLKM
GYSGKTTIRSWNRNMSTWTDMQSVPNQECNIYGHCGPSGYCENTQSVVTCKCLDGFQPNN
KEDWALGRFSQGCHRKEALSCDQGDSFLTLSTMKVPDKFLYVKNRSFDECTAECTRNCSC
TAYAYANMSTKVTYGDETRCLLWMGDLIDTEKLIGHGENLYIRVNGLSGIVYCFHFSARL
IKVYIVVGEY
Download sequence
Identical sequences I1I136
EG:BRADI3G15480.1 15368.BRADI3G15480.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]