SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G15680.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI3G15680.1
Domain Number - Region: 215-400
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000213
Family NRPS condensation domain (amide synthase) 0.032
Further Details:      
 
Domain Number - Region: 63-185
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000222
Family CAT-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G15680.1   Gene: BRADI3G15680   Transcript: BRADI3G15680.1
Sequence length 450
Comment pep:novel chromosome:Brachy1.0:3:13963715:13965908:-1 gene:BRADI3G15680 transcript:BRADI3G15680.1
Sequence
MPSSTKILEVHRVVVPPATGESPPPPLLKLSALDAPWLLVPLIQRLLLFVDSDAGQDKLP
PFASLAATLARFPPLAGRIVHLPDTGDAAIDCSSEEALDRGVRFVVTECLGSDAATLAGD
ADHDVAAFKRLVPELETGALPAEAMAVQVTRLKGGVAVGVAMHHAVVDGRSVWTFLEAWA
AACRGDGAAVGTNLPVFDRAAMALPGGEELARSTLRKYTPDLPAVVQWPLTRILPRRTFT
VTAHHMLRLKHRITALTSSSSTAAPSSFASIAALAWVSFVRSKHPATISADHDVYLFVYI
DCRGRRAIEPPVSEDYFGTCITGCLIREEARDLLDDKDGAGIAAAATAVREGVRRATEDP
LASWDWMSLASSSLPQDRVVSMNGSTRFSAYEATDFGWGAPCRTELVTMNHGGQVVLVAA
KGGSGGVQASVCMEPEHMDAFSSHFLNSLD
Download sequence
Identical sequences I1I156
15368.BRADI3G15680.1 EG:BRADI3G15680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]