SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G15730.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G15730.1
Domain Number 1 Region: 71-193
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.00000278
Family CAT-like 0.071
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G15730.1
Domain Number - Region: 296-389
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000578
Family NRPS condensation domain (amide synthase) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G15730.1   Gene: BRADI3G15730   Transcript: BRADI3G15730.1
Sequence length 454
Comment pep:novel chromosome:Brachy1.0:3:13979736:13981998:1 gene:BRADI3G15730 transcript:BRADI3G15730.1
Sequence
MPTVNVVEVARVAPSAPQPEDGPEGSLLLGLSALEVPWIALPLIQRVLIFVDNADADGGV
QQLPPFASMVASLRASLAATLARFPPLAGRIVHLPSTADAAIDCSASDGVRFMVAESEDA
DAARLVGEADHDVGAFRELVPELETGALPAEVLAVQVTRLNGGAAVGVAMHHAVVDGRSV
WRFLAAWAAACRGDGDDAVAPAFERAVVAVPGGEELVRSTLRKYSPNLPLTTMIIPGSGP
TLPRRTFTVTAQHIHRLKQRITDDLTSSPTPYSSFVALAALTWVSFVRSKHPSAISSSSS
SVYLFFFVDCRGRPGIEPPVPESYFGTCISGALAKATARDLLAEDGLAFAAAAVQAEVRR
AAEDPLALWDWMELLHWMPLDRLVNVSGSARFPAYEAADFGWGPPGRTELVTMNAGGQLV
LVAAKGGAGAVQASVCMEAEHMDCFNSHFLGLTG
Download sequence
Identical sequences I1I161
XP_003573419.1.954 EG:BRADI3G15730.1 15368.BRADI3G15730.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]