SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G16990.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G16990.1
Domain Number 1 Region: 127-172
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000000000262
Family BSD domain 0.0024
Further Details:      
 
Domain Number 2 Region: 202-255
Classification Level Classification E-value
Superfamily BSD domain-like 0.000000811
Family BSD domain 0.0088
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G16990.1
Domain Number - Region: 19-104
Classification Level Classification E-value
Superfamily PH domain-like 0.000627
Family TFIIH domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G16990.1   Gene: BRADI3G16990   Transcript: BRADI3G16990.1
Sequence length 602
Comment pep:novel chromosome:Brachy1.0:3:15122614:15131419:-1 gene:BRADI3G16990 transcript:BRADI3G16990.1
Sequence
MGTMTIGAKYKTTLKDPGTTGVLRMNEDKLAFIPNDPRSLMKLNVDFRTIKGHKFNKVDG
SKPTPPLLNLSKDSDKGGGYMFEFDNVGNRDLCRDFVARVLGKHQGIVPPRPNAPPEKSV
AAAGPEQLSSAEMERRMKLLREDSELQKLHKKFVLGNILQESEFWATRKNLLDDEANTAS
KQKPGFRSVMLADVRPSADGQTNKVTFSLTNEIIHQIFAEKPAVHRAFLDYVPKKLSEKD
FWTKYCRAEYLLRTKNTLAAKAEAADDEELAIFLRNDDIVAKEAKLKIKRVDPTLDMEAD
AGDDYIHLPDHGILRDGSRETTDTDSELARRTLSQDLNRHAAVVLEGRKTDVEIADAKTV
AEALARSKTETPCSSIADDASHERLLKVARMTEIEDLQAPRSLPYAPLCIKDPREYFDSQ
QANPLRPLGGDGRKARSCSLSTDDAFRHLMDQISSVKVNKLSCPVVQSNVALKVLNELNE
GISRSRRLNLKNPQDSLLGRLPHRTRDELMDHWTAIQELLRHFWSSYPITTTVLYNKIQR
VKDAMTQIYQKLQDIKESAQPDVRHEISQLVKPMTQALDAAFNHDLEQQQKSSKTGNKPN
GF
Download sequence
Identical sequences I1I1K5
15368.BRADI3G16990.1 EG:BRADI3G16990.1 XP_003573495.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]