SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G17130.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G17130.1
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000972
Family RING finger domain, C3HC4 0.0075
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G17130.1
Domain Number - Region: 236-320
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0471
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G17130.1   Gene: BRADI3G17130   Transcript: BRADI3G17130.1
Sequence length 607
Comment pep:novel chromosome:Brachy1.0:3:15230767:15234157:-1 gene:BRADI3G17130 transcript:BRADI3G17130.1
Sequence
MTAAAWPVCTICYDDLRPLSDQHLHCIPSCGHVFHALCLEQWLEYCPSVGAGGGKTKKGG
TCPICKSACGGAHPPTRLFFQSTGTCLTQAASPASPSQEADPEALAAEVARLEQKAASLG
RTLDEQRDGIQKLNAEASPPVTAIASAGSRGGVRRWKEEAAAAEAMGEKARKEKEFLQQL
LNAKTEEVSRKTAECGRLQERSLGLAKELAALKLSTDMNLEEEEILKLASLGNHGNLENA
VDVLKRSLALRNKSYKELMVQCNQLGRSETRTQQRIEKAKEVISKLKTKVHDLQKELEEK
ENIVLRDLRSSKKFKADLNQTNPGDTTTNNAFPSAGYGQKVKPDEVMQDPYNENPHTNRF
IPEANNDLNLKDNLDCKISDVIDLDADDDPMIRCSARPFGNRGDTVDTRNQSSHYERGNK
EPATFGCESSSYVAEETSFMKHTPATGKSTFQRNLMNTKLQNFQELPVLRSTSVTTSTWK
KDTLTIGGISKQATRLASGTGPQQIHNLNSLSDDDFQAPRTNGLEAARKGVSKWCKGMAA
PGSLSANANKGNLIAVGPDGRGGKVKVLRDHGRFPQDSKTPALWPKAQQKAGGRGGQFQI
EHFFGKR
Download sequence
Identical sequences I1I1M5
15368.BRADI3G17130.1 EG:BRADI3G17130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]