SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G17280.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G17280.2
Domain Number 1 Region: 215-452
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 7.56e-72
Family CAT-like 0.0000199
Further Details:      
 
Domain Number 2 Region: 25-113
Classification Level Classification E-value
Superfamily Single hybrid motif 5.1e-26
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000733
Further Details:      
 
Domain Number 3 Region: 144-185
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000288
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G17280.2   Gene: BRADI3G17280   Transcript: BRADI3G17280.2
Sequence length 452
Comment pep:novel chromosome:Brachy1.0:3:15421090:15426355:1 gene:BRADI3G17280 transcript:BRADI3G17280.2
Sequence
MARANPVTLLPASLAGHYKVGLPPHMVIGMPALSPTMNQGNLAKWRKQEGDKIEVGDVIC
EIETDKATLEFESLEEGYLAKILVPEGSKDVQVGEPIFVTVEESEDIKNIPADTSFGGEQ
KEEQSSGSAAQSVQVDAAETSSVTSRISPAAKMLIKEHGLDASLLKASGPRGTLLKGDVL
AALKSGTASSAKEQTAPVAPSPKPTRDTQAQSPITSQKSDTFEDITNTQIRKVIAKRLLE
SKQTTPHLYLSKDVILDPLLAFRNELKEQHGVKVSVNDIVIKAVALALRNVPEANAYWDT
AKQEAQKCDSVDISIAVATEKGLMTPIIRNADQKTISAISSEVKQLAKKARAGKLAPNEF
QGGSFSISNLGMYPVDHFCAIINPPQAGILAVGRGNKVVEPVMDSDGTEKAAVLTKMSLT
LSADHRIFDGQVGGKFFTELASNFSDIRRLLL
Download sequence
Identical sequences I1I1P6
EG:BRADI3G17280.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]