SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G17567.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G17567.1
Domain Number 1 Region: 257-606
Classification Level Classification E-value
Superfamily RNI-like 3.92e-67
Family 28-residue LRR 0.017
Further Details:      
 
Domain Number 2 Region: 704-999
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.58e-67
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 3 Region: 66-317
Classification Level Classification E-value
Superfamily L domain-like 7.99e-46
Family Polygalacturonase inhibiting protein PGIP 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G17567.1   Gene: BRADI3G17567   Transcript: BRADI3G17567.1
Sequence length 1020
Comment pep:novel chromosome:Brachy1.0:3:15895422:15898484:1 gene:BRADI3G17567 transcript:BRADI3G17567.1
Sequence
MAATTQLPFPFLLLLPLLTITAASSAPLPLLALLALKSSLHDPAGALTPWTYASAASTSP
IARSPPWCSWPGVSCSTADAAIVGIDLSRRNLSGSFSPTAAALLSPTLTSLNLSGNAFSG
EFPPALLLLRRLVTLDVSHNFFNGTFPDGIARLGDSLAVVDAYSNCFVGPIPRGLGQLRQ
LERLNLGGSFFNGSIPPEFGKLRSLRFLHLAGNSLSGRLPPELGELALLERLELGYNSGY
DGGIPPEFGGLKQLQYLDIAQGNLSGALPPELGGLGRLEALFLFKNRLAGAIPPALSRLQ
ALRVLDLSDNRLTGPIPAGLGDLTNLTTLNLMSNSLSGSIPATIGELANLEVLQLWNNSL
TGALPASLGSASRRLVRLDASTNSLSGPIPAELCAGGRLVRLILFANRLESSIPSSLASC
ASLWRVRLESNRLSGSIPAGFGKLKNLTYMDLSSNNLSHGGGIPPDLLACRSLEFLNVSS
NPELGGEIPEHAWRAPRLQVFSASGCGLHGEIPAFSGGCANLYGIELGWNSLSGAIPGDV
GGCRRLVSLRLQHNRLEGEIPASLESLPSVTDVDLSYNLLVGDVPPGFANSTTLETFDVS
FNNLSSKAAPPVVGPGEIATTTRRTAAMWVSAVAVALAGLAVLALTARWLRCLEEEEDGG
GSSGASGGGGGDKQGVGPWRMTAFQKLGFTAEDVARCVEVGGVVVGAGSSGTVYRAKMPN
GDVIAVKKLWQSHKDSASPESHEAPTKKKRVVAEVEMLGQLRHRNIVRLLGWCTNAEGTS
TMLLYEYMPNGSLHDLLHPENGRKKTSKEAAAEWWETRHRIAVGVAQGLSYLHHDCVPAV
AHRDVKPSNILLDADLEARVADFGAAKALLHGDGAAMAMSTVAGSYGYMAPEYARTLRVD
GEKSDVYSFGVVLLEIVTGRRAVEPDEFGEGCGIVDWARRKVAAAGTGGVWSEVMMEQGS
GGGEGEREEMAAVLRVALLCTSRCPRERPSMRDVLAMLQQARPARNSAAAKAKAAEQVPA
Download sequence
Identical sequences I1I1T1
XP_010236470.1.954 EG:BRADI3G17567.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]