SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G20867.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G20867.1
Domain Number 1 Region: 195-541
Classification Level Classification E-value
Superfamily L domain-like 6.8e-68
Family Polygalacturonase inhibiting protein PGIP 0.004
Further Details:      
 
Domain Number 2 Region: 850-1141
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-66
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 3 Region: 478-766
Classification Level Classification E-value
Superfamily L domain-like 4.76e-59
Family Polygalacturonase inhibiting protein PGIP 0.0043
Further Details:      
 
Domain Number 4 Region: 75-251
Classification Level Classification E-value
Superfamily L domain-like 1.22e-26
Family Polygalacturonase inhibiting protein PGIP 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G20867.1   Gene: BRADI3G20867   Transcript: BRADI3G20867.1
Sequence length 1146
Comment pep:novel chromosome:Brachy1.0:3:19848193:19851724:-1 gene:BRADI3G20867 transcript:BRADI3G20867.1
Sequence
MSQFPLLLLLLFFLPLVTSAPPPPPNTSAAAGTGSTTAILLSFLAALPPAAQRFLLPTWL
RTGVNHTSSPASKRHHHHHCAFLGVTCSAATTGEVSAVNLSGSGLSGALASSAPRLCALP
ALAALDLSRNSLTGPVPAALAACSALTELVLAFNLLSGTVPAELLSSRSLLRKLDLNTNA
LTGDIPPSPSMILEYLDLSANSFSGEIPPEFSALPRLTYLDLSNNNLSGPIPEFSAPCRL
LYLSLFSNKLAGELPQSLANCVNLTVLYLPDNEISGEVPDFFAAMPNLQKLYLGDNAFTG
ELPASIGELVSLEELVVSNNWFTGSVPGAIGRCQSLTMLYLNGNRFTGSIPLFIGNLSQL
QMFSAADNGFTGRIPPEVRNCRGLVDLELQNNSLSGTIPPEIAELSQLQKLYLFNNLLHG
PVPPALWRLADMVELYLNNNSLSGEIHSEITHMRNLREITLYSNSFTGELPQDLGFNTTP
GIVRVDLTGNRFHGAIPPGLCTGGQLAILDLGDNLFDGGFPSEIAKCQSLYRLKLNNNQI
SGSLPADLGTNRGLSYVDMSGNRLEGRIPAVIGSWSNLTMLDLSGNNLLGPIPGELGALS
NLVTLRMSSNMLTGLIPHQLGNCKILVCLDLGNNLLNGSLPAEVTTLGSLQNLLLDRNNF
TSAIPDSFTATQALLELQLGDNYFEGAIPHSLGNLQYLSKTLNISNNRLSSQIPSSLGNL
QDLEVLDLSENSLYGPIPPQVSNMISLLVVNLSFNELSGQLPASWVKFAARSPEGFSGNP
HLCVRSDIDAPCSSKKQSVKNRTSRNSWIIVALVLPTVVVLVAALFAIHYIVKMPGRLSA
KRVSLRSLDSTEELPEDMTYEDILRATDNWSEKYVIGKGRHGTVYRTDCKLGKQWAVKTV
DLSQCKFPIEMKILNTVKHRNIVRMAGYYIRGNVGLILYEYMPEGTLFELLHERKPQVAL
GWMARHQIALGVAQGLSYLHQDCVPMIVHRDVKSSNILMDVELVPKLTDFGMGKIVGDED
SDATVSVIVGTLGYIAPEHGYSTRLSEKSDVYSYGVVLLELLCRKMPVDSAFGDGVDIVT
WMRSNLKQADHCSVMSCLDEEIVYWPEDEQAKALHLLDLAISCTEVACQLRPSMREVVNV
LVRMDK
Download sequence
Identical sequences I1I2W3
EG:BRADI3G20867.1 XP_003571653.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]