SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G21400.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G21400.1
Domain Number 1 Region: 799-1101
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-74
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 205-518
Classification Level Classification E-value
Superfamily RNI-like 1.29e-62
Family 28-residue LRR 0.047
Further Details:      
 
Domain Number 3 Region: 60-240
Classification Level Classification E-value
Superfamily L domain-like 1.87e-26
Family Polygalacturonase inhibiting protein PGIP 0.0075
Further Details:      
 
Domain Number 4 Region: 554-703
Classification Level Classification E-value
Superfamily L domain-like 2.55e-26
Family Polygalacturonase inhibiting protein PGIP 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G21400.1   Gene: BRADI3G21400   Transcript: BRADI3G21400.1
Sequence length 1116
Comment pep:novel chromosome:Brachy1.0:3:20476998:20480348:-1 gene:BRADI3G21400 transcript:BRADI3G21400.1
Sequence
MAMDKLFLLLPIVLLLLSSVSSETDDAGALLRFKASVHKDPRNLLSSWQQAASGSGGNGN
GTYYCSWYGVSCDGDGRVSRLDLSGSGLAGRASFAALSFLEALRQLNLSGNTALTANATG
DLPKLPRALETLDLSDGGLAGALPDGDMQHRFPNLTDLRLARNNITGELSPSFASGSTTL
VTLDLSGNRLTGAIPPSLLLSGACKTLNLSYNALSGAMPEPMVSSGALEVLDVTSNRLTG
AIPRSIGNLTSLRVLRASSNNISGSIPESMSSCGALRVLELANNNVSGAIPAAVLGNLTS
LESLLLSNNFISGSLPATIASCKSLRFVDLSSNKISGSLPDELCAPGAAAALEELRMPDN
LLTGAIPPGLANCTRLKVIDFSINYLSGPIPKELGRLGDLEQLVAWFNGLDGRIPAELGQ
CRSLRTLILNNNFIGGDIPVELFNCTGLEWVSLTSNRISGGIRPEFGRLSRLAVLQLANN
TLSGTVPKELGNCSSLMWLDLNSNRLTGEIPLRLGRQLGSTPLSGILAGNTLAFVRNAGN
ACKGVGGLVEFAGIRPERLLEVPTLKSCDFTRLYSGAAVSGWTRYQMTLEYLDLSYNSLN
GTIPVELGDMVVLQVLDLARNKLTGEIPASLGRLHDLGVFDVSHNRLQGGIPESFSNLSF
LVQIDVSDNDLTGEIPQRGQLSTLPASQYADNPGLCGMPLLPCSDLPPRATMSGLGPAPD
SRSSNKKRSLRANVLILAALVTAGLACAAAIWAVAVRARRRDVREARMLSSLQDGTRTAT
TWKLGKAEKEALSINVATFQRQLRKLTFTQLIEATNGFSAASLIGSGGFGEVFKATLKDG
SCVAIKKLIPLSHQGDREFMAEMETLGKIKHKNLVPLLGYCKIGEERLLVYEYMTHGSLE
DTLHLRRHDGDGGSGAPSSLSWEQRKKVARGAAKGLCFLHHNCIPHIIHRDMKSSNVLLD
AAMEAHVADFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSLGVVLLE
LLTGRRPTDKEDFGDTNLVGWVKMKVREGTGKEVVDPELLKAAAAVNETEKEMMMFMEIA
LQCVDDFPSKRPNMLQVVAVLRELDAPPQERLPAVA
Download sequence
Identical sequences I1I325
EG:BRADI3G21400.1 15368.BRADI3G21400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]