SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G21580.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G21580.1
Domain Number 1 Region: 508-826
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-71
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 100-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000824
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G21580.1
Domain Number - Region: 225-284
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000236
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Domain Number - Region: 375-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0451
Family Pan module (APPLE domain) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G21580.1   Gene: BRADI3G21580   Transcript: BRADI3G21580.1
Sequence length 845
Comment pep:novel chromosome:Brachy1.0:3:20740829:20743647:-1 gene:BRADI3G21580 transcript:BRADI3G21580.1
Sequence
MASLFFLPLLPRAGVLFLVLALAARHGDAQAQPQPDQMISFSANDTRPWVATQSSRVLVS
PNLTMAAGFVPSEEVPSTGKFRFAVWVVANDTGGKTGKTIIWHAHNGNKVALEADGNSTL
VVNAAGALTWAANDSTTVWSTPRTNATAPRLTLNETGSLRFGDWASFAEPTDTLMPGQAI
PKVQNNSGTITLQSADGRYRFVDSMALKYVNSADPASIPTYANMTGPSTLLNLTTDGTMQ
LSAGNPPQLIASDMGAKNRLRRLRLDDNGNLRLYSLLPGTRQWRIVWELVQELCTIQGTC
PGNNTICVPAGADGVSCVCPPGFRPAPTGCEHKKRYSGRGDDDKFVRLDFVSFSGGAPTK
ASDPGRFMNNSKSPSNLIACEKFCREDRNCPAFGYKFGGDRTCLLYKTQLVDGYWSPATE
MSTFVRVVKTDTDKNNFTGMVTKIETVCPVQLALPVPPKPKRTTIRNIAIITALFAVELL
AGVLSFWAFLRKYSQYREMARTLGLEYLPAGGPRRFSYAELKAATKDFTDVVGRGAYGTV
FRGELPDRRAVAVKQLHGVGGGEAEFWAEVTIIARMHHLNLVRMWGFCADKDQRMLVYEY
VPNGSLDKYLFSSSSSAPATGSGSGDESEQLQSGQQVALDLHTRYRIALGVARAIAYLHE
ECLEWVLHCDIKPENILLEDDFCPKVSDFGLSKLTSKKEKVTMSRIRGTRGYMAPEWVIH
REPITAKADVYSFGMVLLEIVSGRRNYGFRQESVGSEDWYFPKWAYEKVYVERRIEDIMD
PRILLRVDDDAESVATVERMVKTAMWCLQDRAEMRPSMGKVAKMLEGTVEITEPVKPTIF
CVQDD
Download sequence
Identical sequences I1I349
15368.BRADI3G21580.1 XP_010234615.1.954 EG:BRADI3G21580.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]