SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G24417.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G24417.1
Domain Number 1 Region: 1808-2199
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.55e-99
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000222
Further Details:      
 
Domain Number 2 Region: 1475-1803
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.22e-73
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000558
Further Details:      
 
Domain Number 3 Region: 159-394
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.38e-60
Family BC ATP-binding domain-like 0.000000353
Further Details:      
 
Domain Number 4 Region: 15-157
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.59e-49
Family BC N-terminal domain-like 0.00000283
Further Details:      
 
Domain Number 5 Region: 424-512
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.61e-19
Family BC C-terminal domain-like 0.0000615
Further Details:      
 
Domain Number 6 Region: 645-718
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0000000236
Family Biotinyl/lipoyl-carrier proteins and domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G24417.1   Gene: BRADI3G24417   Transcript: BRADI3G24417.1
Sequence length 2238
Comment pep:novel chromosome:Brachy1.0:3:23965926:23977275:1 gene:BRADI3G24417 transcript:BRADI3G24417.1
Sequence
MVESGQINSMSNSRHPSLPSEVDEFCKALGGDSPIHSVLVANNGMAAVKFMRSIRTWALE
TFGTEKAILLVAMATPEDLKINAEHIRIADQFLEVPGGTNNNNYANVQLIVEIAERTRVS
AVWPGWGHASENPELPDALKEKGIIFLGPPSAAMAALGDKIGSSLIAQAAGVPTLPWSGS
HVKVPPETCHSIPEDIYKNACVSTTEEAVASCQVVGYPAMIKASWGGGGKGIRKVHNDEE
VRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKHGNVAALHSRDCSVQRRHQKIIE
EGPITVAPPETVKELEQAARRLAKCVQYEGAATVEYLYSMETGEYYFLELNPRLQVEHPV
TEWIAEINLPASQVAVGMGIPLYNIPEIRRFYRMEHGGGYHAWKEISSAATKFDLDKAES
ARPRGHCVAVRVTSEDPDDGFKPTSGRVEELNFKSHVFAFGESRSLAIANMVLGLKEIQI
RGEIRTNVDYTVDLLNASEYRENKIHTGWLDSRIAMRVRAERPPWYLSVVGGALYEASSR
SSTVVTDYVGYLSKGQIPPKHISLVNLTVTLNIEGSKYTIETVRGGPRSYKLRINESEIE
AEIHSLRDGGLLMQLDGNSHVIYAETEAAGTRLLINGRTCLLQKEHDPSKLLADTPCKLL
RFLVVDGSHVVSDTPYAEVEVMKMCMPLLLPASGVIHFVMPEGQAMQASDLIARLDLDDP
SSVRRAEPFQGTFPKLGPPTAVSGKVHQKFAASVNSAHMILAGYEHNINQVVQDLLNCLD
SPELPFLQWQEIMSVLATRLPKDLRNELDGKYKEYELNADFRKSKDFPAKLLRGVIEANL
AYCSEKDRVTNERLVEPLMSLVKSYEGGRESHARVVVKSLFEEYLSVEELFSDDIQSDVI
ERLRLQHAKDLEKVVYIVFSHQGVRNKNKLILRLMEALVYPNPSAYRDQLIRFSALNHTA
YSGLALKASQLLEHTKLSELRTSIARSLSELEMFTEEGERVSTPRRKMAINERMEDLVCA
PLAVEDALVALFDHSDPTLQRRVVETYIRRLYQHYLVRGSIRMQWHRSGLIALWEFSEEH
IAQRNGQSATVLNQQVDHPIYKRWGVMVVIKSLQFLSTAIEAALKETSHYGAGVGNISNC
NPVTPNSSNMLHIALVGINNQMSTLQDSGDEDQAQERINKLSKILKDNTITSHLNGAGVR
VVSCIIQRDEGRPPMRHSFQWSVDRLYYEEDPMLRHVEPPLSTFLELDKVNLEGYNDVKY
TPSRDRQWHIYTLVKNKKDQRSNDQRMFLRTIVRQPSVTNGFLPGSIDNEVSRAQASSSF
TSNSILRSLMAALEEIELHAHNEAVRSGHSHMYLCIMREQQLFDLIPFSRMSGEVGQDEA
TTCTLLKHIVLNIYEHVGVRMHRLSVCQWEVKLWLACDGQANGAWRVVVTNVTGHTCTVD
IYREVEDPNIHQLFYRSATPTAGPLDGVALHEPYKPLDAIDLKRYAARKNETTYCYDFPL
AFETALKKSWKSSISHVGEANEHNRRYVKVTELMFADSTGSWGTPLVPVERSPGINDIGI
VAWSMKLSTPEFPGGREIIVVANDVTFKAGSFGPREDAFFDAVTNLACERKIPLIYLSAT
AGARIGVAEEIKSCFHVGWFDDQSPERGFHYIYLTEEDYSRLSSSVIAHELKLETGETRW
VVDTIVGKEDGLGCENLHGSGAIASAYSKAYRETFTLTFVTGRAVGIGAYLARLGMRCIQ
RLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATNGVVHLTVSDDLEGVFAILKWLS
YVPPYVGGPLPILKPLDPPDRPVTYFPENSCDARAAICGIQDSQGKWLGGMFDRGSFVET
LEGWAKTVITGRAKLGGIPVGVIAVETQTMMQVIPADPGQLDSAERVVPQAGQVWFPDSA
TKTAQALLDFNHEELPLFILANWRGFSGGQRDLFEGILQAGSTIVENLRTYKQPAFVYIP
KAGELRGGAWVVVDSKINPEHIEMYAESTAKGNVLEAEGLIEIKFRPKELEESMLRLDPE
LTNLNVRLREMKKENASLSEMETIGVSMTVRMKQLMPIYTQVATRFAELHDTSSRMAAKG
VISKVVDWKESRTFFYKRLRRRVAEDSLAKEVREAAGEQLSHRSALECIKKWYLASKGSE
GDSEQWNDNEGFFAWKDDRRNYENYLEELEAERVSKWFSHLAESSDVKALPNGLSLLLGK
MNPTKREQVIDGLRELLG
Download sequence
Identical sequences I1I3Q4
EG:BRADI3G24417.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]