SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G27007.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI3G27007.1
Domain Number - Region: 638-832
Classification Level Classification E-value
Superfamily Tropomyosin 0.00438
Family Tropomyosin 0.021
Further Details:      
 
Domain Number - Region: 987-1078
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00497
Family Myosin rod fragments 0.0077
Further Details:      
 
Domain Number - Region: 923-990
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00549
Family Myosin rod fragments 0.0085
Further Details:      
 
Domain Number - Region: 202-437
Classification Level Classification E-value
Superfamily Tropomyosin 0.0379
Family Tropomyosin 0.0033
Further Details:      
 
Domain Number - Region: 1434-1564
Classification Level Classification E-value
Superfamily Tropomyosin 0.0615
Family Tropomyosin 0.0074
Further Details:      
 
Domain Number - Region: 432-658
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G27007.1   Gene: BRADI3G27007   Transcript: BRADI3G27007.1
Sequence length 2053
Comment pep:novel chromosome:Brachy1.0:3:27750706:27758947:-1 gene:BRADI3G27007 transcript:BRADI3G27007.1
Sequence
MAASVGHDSRQYSWLWVSHISPKNSKWLQENLSDMDTKVKAMIKLINEDADSFARRAEMY
YKKRPELMKQVEEFYRAYRALAERYDQATGALRQAHRTISEVFPNQMPSMDESPSSTGQE
MEPHTPEMPTFSRTPFDSGDHSTSKRNGSHPQETSALSERKSLKRFNDLSQSGENAPRAV
FDGKARKGLSFESPEVKGKQDISNEMINLQQEMSRLLTESQNLKHQMLSESERANKAENE
IQSLKDTVFQLNSEKGTSLPQYNQSTERLSTLESELSKAQADLKKLTDEMASEVEKLNSA
ESHNSVLQSELETLDNKARIQQQELEQKLKELENVHLSFQEEHEKRMQAESALLSEGKER
AKSQEEVQRLTIEVKMAHEKLDELMQSNVDLESAVCELKKEVESLTEQNSSFELLIQELR
DEINSLRDSKGELQSETQSLRVTISQLNAEKDGAVLQHQQAVERVDVLMQDLKRKREEVN
SVRGQLQDESHRHTQTEAALLMTKSLHSKLEHEVKGLTQDLDTSRKKLNELENDKLDLEN
TSTELKKTILDLNSDKDAALLQQQRSLEKVSYLGLELSKAQLGLEKSEQKMQAVELEIAQ
KSENVNSLELSLKEEAEKRVQAETSLMSMENMYAQSQEEVNRLHLEIEKLNGKLNELEKL
SSELKSTILLLNTEKDATHLKNQESLMRVSDLESELSKLQAELDKVDGKVQVLEQELKHK
QEEVCILQTSLEDETQKRVEGEATLLSVTSLHSESLEDVNRLAMDIEKLTGKLNEVENSK
RDLENMVNKHTEAINSLHEQNLSTELIVGGLHRELDALKALNLKLEAEMGSHIGEKEALQ
KDFARQREEKENLDSRHHALTDEMDALKSSIAAKHNLIAELQSTNLKLKEVCAKNLIEKA
LLSEKVQEMEKLSEEYSLMENSISDANAEMDGLREKIKALESSESSLKAKVLSCVSEKAV
LVSELENLGKRFADISKNNSTLEFSLSDTKAECEVFRTKLKDCEERLQTQLANNSALSAE
KNNLFSQMENITVVMKALEGKHANLEEKHSSLSRENDLVHDQVRKLQGLLRTINAEYEDA
VKSHEMHANRLEEQISSLQEKMHHMDERLEQEEQTSMSASISLMVLEDSLADMKDKNVAL
FKKCQKYVEENHSADILISQLEDEARHHEVERKTLLNLNGKLREGISQHMKILSINKDLG
PAEDEILLQTVSDETSNILKLKEESEDVNMLSYTELSVLTTVMLQIAMESRDLYLQKCAL
EKEVENEAAELLSLKNKNCQLLKCNEQLSQELQKGCEREQVQKTEVLVLHAKLSCLTESY
QTAQDEIIDMTEKNGSLSKEQQSLIEKYNALEDENGTVLAECMMLEHLSLFLRGHNNEVA
SALVSLTDEMALLSLVKGELDSEVKAMSARALMLESENNHLKKYLVYLVDVFRTRFVLLE
FDLNNAKSVCQELAIELESCMVQLIQKDDELLEAEENAQLTQEKNRELCGVVGALQVGIE
GAKVMKGELENKITTLTRECTTKDDEIFLLRQANETLQADAAILKEKEQSLGSAHELMLK
EVEQHEREFVLLVGDAITSSVNAAVYEEKIIEFMKEAKDIEISAIAQRERIENEIFSRDG
HFEALLEKATGVQEENAELIAELSKHAALVGSLSDHIYVLEEDILSLSKPHCTEVIEETK
VGPSMQEDDHGPESRRFPTGTLELQQLMSRIEALRAFILNAKDRRDQESTNFAAKLAAAN
IENQELRARGGLEAKEIYSDNERQKDADGPKGKQVQMMKDIELDQISTCPPYGTGAALYP
LGTGANAEMDDEMLQLWEAAERSCKNQTAKSSSSEHDIQAVEEVKSEYPSSELVRGRDLG
INKLEMSSASMVEPHEVWGNNVVDRLSSDAQRLLSIQESIEELKRKMGGPSKGRSPMNSE
YNSVSAQLHETEGFVLEQINLNRKLAKRAENYPALSDSMNAEQESIPSRRKISEQVQKGS
ENVARLELELQKIQYVLLKLEEENEYRRLKVSDKRTRVLLRDYLYGRKDHRSGSQKRRAP
FCGCVGSKSRTEP
Download sequence
Identical sequences I1I439
EG:BRADI3G27007.1 XP_003571793.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]