SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G27852.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G27852.1
Domain Number 1 Region: 205-389
Classification Level Classification E-value
Superfamily Bet v1-like 7.28e-40
Family STAR domain 0.0034
Further Details:      
 
Domain Number 2 Region: 4-120
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000897
Family Pleckstrin-homology domain (PH domain) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G27852.1   Gene: BRADI3G27852   Transcript: BRADI3G27852.1
Sequence length 726
Comment pep:novel chromosome:Brachy1.0:3:29021951:29031004:1 gene:BRADI3G27852 transcript:BRADI3G27852.1
Sequence
MSSSSSTVVYEGWMVRHGRRKIGRSFIHMRYFVLETRLLSYFKRKPQHKMPKLPIKSLHI
DGNCRVEDRGLKMHHGHMLYVLCVYNKREKHHRITMAAFNIQEALIWKEKIEMVIDQQQG
VVPPDGDTAFSSSQQKASIENGRKSSSSDRESQYSHEEEEEEEENQRALMRRTTIGNGPP
ESLRDWTRGNDLGISDQGSPAQVFSRGHWRLVRCQNGLRIFEELQDVDYLARSCSRAMKA
VGVVEASCEAIFQLVMSMDTTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFSVFVWP
RDLCYVRYWRRNDDGSYVVLFQSREHPNCGPQPGFVRAHIESGGFNISPLKSRNGRVRTQ
VQHLMQIDLKGWGVGYVPSFQQHCLLHMLNSVAGLREWFSQSDESQILPRIPVMDNMSLS
ISSKKGKKTQDNTVQTSLPMDQSRNSTMLDEESDEDEDFQLPESEQEPSTRELDADGKLL
GLDEEDSDEIDLSGFSGNLRRDDRDNSRDCWRISDGNNFRVRSKNFIYDKSKVPAGKPLM
ELVAVDWFKDVKRMDHVAKRKGCPVQVAAEKGLFALAINLQVPGTTNYSMVFYFVTKKLI
PSSLLQRFVDGDDEFRNSRFKLIPSVPKGSWIVRQSVGSTPCLLGKAVDITYIRGANYLE
IDVDIGSSTVANGVLGLVCGVITTLVVDMAFLVQGNAYEELPERLIGAVRMSHIELSSAI
VPVLDD
Download sequence
Identical sequences I1I4E2
XP_010234787.1.954 EG:BRADI3G27852.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]